Global Patent Index - EP 0791011 B1

EP 0791011 B1 20000517 - BIOLOGICALLY ACTIVE TGF-BETA1 AND TGF-BETA2 PEPTIDES

Title (en)

BIOLOGICALLY ACTIVE TGF-BETA1 AND TGF-BETA2 PEPTIDES

Title (de)

BIOLOGISCH AKTIVE TGF-BETA1 UND TGF-BETA2 PEPTIDE

Title (fr)

PEPTIDES DE TGF-BETA1 ET TGF-BETA2 BIOLOGIQUEMENT ACTIFS

Publication

EP 0791011 B1 (EN)

Application

EP 94907287 A

Priority

  • US 944893 A
  • US 9400782 W

Abstract (en)

[origin: US5658883A] The invention relates to peptides corresponding to regions of the amino acid sequence of TGF- beta 1 or TGF- beta 2 which retain, either in monomeric or polymeric forms, at least some of the biological activity of the respective full length TGF- beta . The monomeric form of the peptide derived from TGF- beta 1 comprises the following amino acid sequence: CVRQLYIDFRKDLGWKWIHEPKGYHANFCLGP (SEQ ID NO: 1). The monomeric form of the peptide derived from TGF- beta 2 comprises the following amino acid sequence: CLRPLYIDFKRDLGWKWIHEPKGYNANFCAGA (SEQ ID NO: 2). Dimers may be formed via disulfide bonds between the amino-terminal cysteine residues, the carboxy-terminal cysteine residues, or amino- and carboxy-terminal cysteine residues of the monomer subunits.

IPC 1-7

C07K 14/495; A61K 38/18

IPC 8 full level

A61K 38/22 (2006.01); A61P 19/00 (2006.01); A61P 29/00 (2006.01); A61P 43/00 (2006.01); C07K 14/495 (2006.01); A61K 38/00 (2006.01)

CPC (source: EP US)

A61P 19/00 (2018.01 - EP); A61P 29/00 (2018.01 - EP); A61P 43/00 (2018.01 - EP); C07K 14/495 (2013.01 - EP US); A61K 38/00 (2013.01 - EP); Y10S 930/12 (2013.01 - EP)

Designated contracting state (EPC)

DE ES FR GB IT

DOCDB simple family (publication)

US 5658883 A 19970819; AU 6093294 A 19940815; AU 685084 B2 19980115; CA 2153789 A1 19940804; CA 2153789 C 20070417; DE 69424576 D1 20000621; DE 69424576 T2 20010118; EP 0791011 A2 19970827; EP 0791011 B1 20000517; ES 2146253 T3 20000801; JP 3763479 B2 20060405; JP H08510443 A 19961105; US 5420243 A 19950530; WO 9417099 A2 19940804; WO 9417099 A3 19950105

DOCDB simple family (application)

US 40060795 A 19950308; AU 6093294 A 19940121; CA 2153789 A 19940121; DE 69424576 A 19940121; DE 69424576 T 19940121; EP 94907287 A 19940121; ES 94907287 T 19940121; JP 51721994 A 19940121; US 9400782 W 19940121; US 944893 A 19930126