Global Patent Index - EP 1025255 A1

EP 1025255 A1 2000-08-09 - METHOD FOR PREPARING A SUBSTITUTED BENZAMIDE

Title (en)

METHOD FOR PREPARING A SUBSTITUTED BENZAMIDE

Title (de)

VERFAHREN ZUR HERSTELLUNG EINES SUBSTITUIERTEN BENZAMID

Title (fr)

PROCEDE DE PREPARATION D'UN BENZAMIDE SUBSTITUE

Publication

EP 1025255 A1 (FR)

Application

EP 98951543 A

Priority

  • FR 9802274 W
  • FR 9713368 A

Abstract (en)

[origin: FR2770214A1] Production of halogenated benzamides is effected by enzymatic hydrolysis of halogenated benzonitriles using a Brevibacterium nitrile hydratase defined as being a tetrameric enzyme of structure alpha 2 beta 2 having at least 50%, preferably more than 80%, homology with the amino acid sequences of the alpha chain and the beta chain. MSVTIDHTTENAAPAQAPVSDRAWALFRA LDGKGLVPDGYVEGWKKTFEEDFSPRRGA ELVARAWTDPEFRQLLLTDGTAAVAQYGY LGPQGEYIVAVEDTPTLKNVIVCSLCSCTA WPILGLPPTWYKSFEYRARVVREPRKVLSE MGTEIASDIEIRVYDTTAETRYMVLPQRPAG TEGWSQEQLQEIVTKDCLIGVAIPQVPTV ( alpha chain). MDGVHDLAGVQGFGKVPHTVNADIGPTFH AEWEHLPYSLMFAGVAELGAFSVDEVRYV VERMEPRHYMMTPYYERYVIGVATLMVEK GILTQDELESLAGGPFPLSRPSESEGRPAPVE TTTFEVGQRVRVRDEYVPGHIRMPAYCRGR VGTISHRTTEKWPFPDAIGHGRNDAGEEPTY VKFAAEELFGSDTDGGSVVVDLFEGYLEPAA ( beta chain). Also CLAIMED are: (1) the benzamide produced by the above method; and (2) 2,6-difluorobenzamide obtained by the hydrolysis of 2,6-difluorobenzonitrile, using the above method.

IPC 1-7 (main, further and additional classification)

C12P 13/02

IPC 8 full level (invention and additional information)

C12N 9/78 (2006.01); C07C 233/65 (2006.01); C12P 13/02 (2006.01); C12R 1/13 (2006.01)

CPC (invention and additional information)

C12P 13/02 (2013.01)

Designated contracting state (EPC)

AT BE CH CY DE DK ES FR GB IE IT LI NL

EPO simple patent family

FR 2770214 A1 19990430; FR 2770214 B1 19991231; CN 1277637 A 20001220; EP 1025255 A1 20000809; JP 2001520891 A 20011106; WO 9922012 A1 19990506

INPADOC legal status


2002-11-27 [18D] DEEMED TO BE WITHDRAWN

- Effective date: 20020501

2000-10-04 [RIN1] INVENTOR (CORRECTION)

- Inventor name: CHASSEAU, LAURENT

2000-10-04 [RIN1] INVENTOR (CORRECTION)

- Inventor name: JOURDAT, CATHERINE

2000-10-04 [RIN1] INVENTOR (CORRECTION)

- Inventor name: PETRE, DOMINIQUE

2000-08-09 [17P] REQUEST FOR EXAMINATION FILED

- Effective date: 20000516

2000-08-09 [AK] DESIGNATED CONTRACTING STATES:

- Kind Code of Ref Document: A1

- Designated State(s): AT BE CH CY DE DK ES FR GB IE IT LI NL