(19)
(11)EP 3 444 745 B1

(12)EUROPEAN PATENT SPECIFICATION

(45)Mention of the grant of the patent:
13.10.2021 Bulletin 2021/41

(21)Application number: 17753460.9

(22)Date of filing:  15.02.2017
(51)International Patent Classification (IPC): 
G06K 9/00(2006.01)
G06F 3/0354(2013.01)
G06F 21/34(2013.01)
G06F 3/0488(2013.01)
(52)Cooperative Patent Classification (CPC):
G06F 3/04883; G06K 9/00; G06F 21/34
(86)International application number:
PCT/KR2017/001638
(87)International publication number:
WO 2017/142299 (24.08.2017 Gazette  2017/34)

(54)

SYSTEM AND METHOD FOR AUTHENTICATING DYNAMIC MOVEMENT TRACKING-BASED HANDWRITTEN SIGNATURE FOR SPACE DIVISION SEGMENT

SYSTEM UND VERFAHREN ZUR AUTHENTIFIZIERUNG EINER DYNAMISCHEN BEWEGUNGSVERFOLGUNGSBASIERTEN HANDSCHRIFTLICHEN SIGNATUR FÜR RAUMTEILUNGSSEGMENT

SYSTÈME ET PROCÉDÉ POUR AUTHENTIFIER UNE SIGNATURE MANUSCRITE À BASE DE SUIVI DE MOUVEMENT DYNAMIQUE POUR UN SEGMENT DE DIVISION SPATIALE


(84)Designated Contracting States:
AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

(30)Priority: 16.02.2016 KR 20160017746

(43)Date of publication of application:
20.02.2019 Bulletin 2019/08

(73)Proprietors:
  • Secuve Co., Ltd.
    Seoul 08390 (KR)
  • Hong, Paul
    Seoul 06966 (KR)

(72)Inventors:
  • HONG, Ki-Yoong
    Seoul 06966 (KR)
  • HONG, Paul
    Seoul 06966 (KR)

(74)Representative: Verscht, Thomas Kurt Albert 
Josephsburgstrasse 88 A
81673 München
81673 München (DE)


(56)References cited: : 
WO-A1-2016/009234
JP-A- 2003 141 543
KR-A- 20070 110 335
KR-A- 20110 053 783
KR-B1- 101 585 842
JP-A- 2002 009 761
KR-A- 20060 057 343
KR-A- 20090 058 145
KR-B1- 101 584 045
KR-B1- 101 585 842
  
      
    Note: Within nine months from the publication of the mention of the grant of the European patent, any person may give notice to the European Patent Office of opposition to the European patent granted. Notice of opposition shall be filed in a written reasoned statement. It shall not be deemed to have been filed until the opposition fee has been paid. (Art. 99(1) European Patent Convention).


    Description

    TECHNICAL FIELD



    [0001] The present disclosure relates to a handwritten signature authentication system and method and, more particularly, to a system and method of authenticating a hand-written signature based on dynamic movement tracking of spatial-division segments, in which handwritten signature authentication is performed by handwritten signature characteristics information (i.e. overall handwritten signature block characteristics information (Q), overall spatial-division segment block characteristics information (V), overall spatial-division segment block position information (P) including sub-segment block position information, and overall spatial-division segment block correlation characteristics information (C), spatial-division segment dynamic behavioral characteristics information (ψi), overall segment dynamic behavioral characteristics information (Ψ), segment transition dynamic behavioral characteristics information (ti) generated during a segment transition while the handwritten signature is made, and an overall segment transition dynamic behavioral characteristics information (T)) based on spatial-division segment blocks including handwritten signature images (Hereinafter, referred to as "segments" or "segment images") divided by a spatial unit.

    BACKGROUND ART



    [0002] With the development of application-based smart devices such as smartphones and smart pads and the development of mobile communication technologies and Internet communication technologies, people can easily and simply use various services through the Internet and the applications.

    [0003] Most services require user authentication before the services are provided to the user because a third party may use the services by stealing the user's identity.

    [0004] While user authentication can be performed with the user's identification card or driver's license in a presence of the user in the offline environment, in the online environment where the service provider does not come into contact with users, different methods of user authentication are needed.

    [0005] Accordingly, various technologies have been developed and applied to verify the user's identity of the personal information entered for use of the services.

    [0006] Such technologies may include an Internet Personal Identification Number (I-PIN) authentication, Short Message Service (SMS) authentication, Automatic Response System (ARS) authentication, and electronic signature or digital signature authentication.

    [0007] According to the SMS authentication, for example, the service server may transmit an authentication code to a mobile terminal (i.e., a mobile phone or a smartphone) of the user through SMS so that the user may input the received authentication code into a web page or an application program, and verify the user by determining whether the authentication code entered by the user matches the authentication code registered for the mobile terminal.

    [0008] However, the above-described technologies have a risk of being used illegally by a third party when the mobile terminal is lost or personal information is leaked.

    [0009] Therefore, there is a trend toward hybrid methods that employ two or more of the above technologies to enhance user security, which is increasing demand for additional technologies for more accurate user authentication.

    [0010] One of such technologies being developed for enhancing the security can be handwritten signature authentication, which is one of biometric information reflecting personal characteristics of each user.

    [0011] The handwritten signature authentication technology may be divided into two categories: image comparison method that examines match rates of the images of handwritten signatures and a behavioral characteristics data comparison method that compares behavioral characteristics data when a signer handwrites a signature.

    [0012] Typically, a handwritten signature authentication method employing the image comparison method has a risk that the third party copies the signature image of the user. In this case, the system may determine that the copied signature of the third party matches the actual signature of the user.

    [0013] Because of such a problem, the behavioral characteristics data comparison method is preferred in a handwritten signature authentication system.

    [0014] A handwritten signature authentication system employing the behavioral characteristics data comparison method performs handwritten signature authentication by extracting and storing the characteristics of the user's signature patterns, such as pressure, speed, intersection points, and inflection point angles. However, the behavioral characteristics comparison method also often leads to cases where a third party copies the behavioral characteristics to some extent when copying a handwritten signature image. In some cases, the traditional handwritten signature authentication system determines that two signatures match on the basis of similar behavioral characteristics even when the images of the two signatures are completely different.

    [0015] Therefore, there is a demand for a method for a handwritten signature authentication system that can distinguish handwritten signatures more accurately, thereby enhancing security with higher levels of handwritten signature recognition and authentication precision.

    [0016] From KR 101 585 842 B1 a manual signature authentication system is known which registers a manual signature including manual signature feature information based on segments, which are classified by word spacing of a user in case of a manual signature, obtains the manual signature feature information based on the segments from the manual signature that the user writes in case of requesting a manual signature authentication, and compares pre-registered manual signature feature information based on the segments with the obtained manual signature feature information based on the segments to authenticate the manual signature.

    [0017] From KR 101 584 045 B1 a manual signature authentication system is known which registers a manual signature including manual signature feature information based on segments, which are classified by word spacing of a user in case of a manual signature, obtains the manual signature feature information based on the segments from the manual signature that the user writes in case of requesting a manual signature authentication, and compares pre-registered manual signature feature information based on the segments with the obtained manual signature feature information based on the segments to authenticate the manual signature.

    [0018] From EP 3 171 328 A1 a handwriting analysis test with obstacle to visa signatures with a naked eye is known wherein the procedure consists to sign over a/some obstacle(s) placed and stuck in a spot of the document to be visaed or in another external support of such document, where the mentioned obstacle(s) produces at least one physical step/obstacle that causes a physical resistance in the advance of the ink instrument used to sign, such signature must be affixed in situ over such obstacle(s), and the result to affix the signature over the obstacle(s) is collated against the indubitable signature of the person who with own sign authorizes or approves the content of the document to be visaed; and this procedure can be repeated the times that the signature inspector deems convenient.

    [0019] From JP 2002 009 761 A a hand-written signature authentication device is known that increases the number of parameters to enhance an authentication rate because the number of the parameters used for signature authentication is inevitably decreased resulting in increasing the opportunity of mis-authentication when the number of strokes and stroke amounts of handwriting are small.

    [0020] JP2003 141 543 A discloses a system to search corresponding points between the signature area of an input image and a reference image at high speed while efficiently taking up writing variations and to perform fast processes including cutting out the signature area from the input image.

    DISCLOSURE OF INVENTION


    TECHNICAL PROBLEM



    [0021] The present disclosure provides a system and method of authenticating a handwritten signature based on dynamic movement tracking of spatial-division segments, in which handwritten signature authentication is performed by handwritten signature characteristics information (i.e. overall handwritten signature block characteristics information (Q), overall spatial-division segment block characteristics information (V), overall spatial-division segment block position information (P) including sub-segment block position information, and overall spatial-division segment block correlation characteristics information (C), spatial-division segment dynamic behavioral characteristics information (ψi), overall segment dynamic behavioral characteristics information (Ψ), segment transition dynamic behavioral characteristics information (ti) generated during a segment transition while the handwritten signature is made, and an overall segment transition dynamic behavioral characteristics information (T)) based on spatial-division segment blocks including handwritten signature images (Hereinafter, referred to as "segments" or "segment images") divided by a spatial unit.

    TECHNICAL SOLUTION



    [0022] In order to accomplish the above object, the present disclosure provides a system as defined in appended independent claim 1 and a method as defined in appended independent claim 11. Preferable embodiments are defined in the appended dependent claims.

    ADVANTAGEOUS EFFECTS



    [0023] According to the present disclosure, a handwritten signature of a signer is divided into segments by a certain spatial unit, and the handwritten signature authentication is performed by using characteristics information of segment blocks containing the divided spatial-division segments, characteristics information of overall handwritten signature block, and correlation information between the segment blocks. Therefore, the present disclosure may perform the handwritten signature authentication based specifically on the segment blocks and improve a recognition rate of the handwritten signature.

    DESCRIPTION OF DRAWINGS



    [0024] 

    FIG. 1 is a block diagram of a handwritten signature authentication system based on dynamic movement tracking of spatial-division segment blocks according to an embodiment of the present disclosure;

    FIG. 2 is a block diagram of a handwritten signature characteristics acquisition unit in the handwritten signature authentication system based on dynamic movement tracking of spatial-division segment blocks according to an embodiment of the present disclosure;

    FIG. 3 illustrates a method of generating segment blocks of a handwritten signature along with characteristics information elements of the segment blocks according to a first embodiment of the present disclosure;

    FIG. 4 illustrates a method of generating segment blocks of a handwritten signature along with characteristics information elements of the segment blocks according to a second embodiment of the present disclosure;

    FIG. 5 illustrates a method of generating segment blocks of a handwritten signature along with characteristics information elements of the segment blocks according to a third embodiment of the present disclosure;

    FIG. 6 illustrates a method of generating sub-segment blocks of the handwritten signature and detecting patterns of the sub-segment blocks according to a first embodiment of the present disclosure, and characteristics information elements of the sub-segment blocks;

    FIG. 7 is a block diagram of a spatial-division segment block characteristics detection unit in the handwritten signature characteristics acquisition unit according to an embodiment of the present disclosure;

    FIG. 8 is a block diagram of a sub-segment block correlation detection unit in the handwritten signature characteristics acquisition unit according to an embodiment of the present disclosure;

    FIG. 9 illustrates a method of generating an inclusion relation of sub-segment blocks which is one of correlation information between the segment blocks according to an embodiment of the present disclosure;

    FIG. 10 illustrates a method of generating a positional relation of sub-segment blocks which is one of correlation information between the segment blocks to according an embodiment of the present disclosure;

    FIG. 11 illustrates a method of generating a positional relation of sub-segment blocks which is one of correlation information between the segment blocks according to an embodiment of the present disclosure;

    FIG. 12 is a flowchart illustrating a handwritten signature authentication method based on dynamic movement tracking of spatial-division segment blocks according to an embodiment of the present disclosure;

    FIG. 13 is a flowchart illustrating a method of collecting handwritten signature characteristics data in the handwritten signature authentication method based on dynamic movement tracking of spatial-division segment blocks according to an embodiment of the present disclosure; and

    FIG. 14 is a flowchart illustrating a method of generating a spatial-division segment block according to an embodiment of the present disclosure.


    BEST MODE



    [0025] The configuration and operation of a handwritten signature authentication system based on dynamic movement tracking of spatial-division segment blocks according to an embodiment of the present disclosure will be described first with reference to attached drawings, and then a handwritten signature authentication method based on dynamic movement tracking of spatial-division segment blocks in the system will be described.

    [0026] In the present disclosure, handwritten signature spatial-division segments (hereinafter, referred to as "spatial-division segments," "handwritten signature segments," "segments," or "segment images" as necessary) refer to parts of a handwritten signature generated by dividing the handwritten signature signed by a signer by a certain spatial unit. Therefore, for a same signature, the number of the handwritten signature segments may differ depending on the signer. For example, the number of the hand-written signature segments (n) for a signature may be one, two, three, or four depending on the signer, even if the signer tries to write the same signature. Similarly, the correlations between the segments will be different as the positions and lengths of the segments will also be different depending on the signer even if the signer tries to write the same signature. According to an embodiment of the present disclosure, the spatial-division segments can be obtained by vertically and/or horizontally dividing an overall handwritten signature block, into segments of equal sizes, by a horizontal space dividing level (Hm) and/or a vertical space dividing level (Vn) which is set previously according to a desired handwritten signature authentication precision. Therefore, the higher the authentication precision is, the larger the horizontal space dividing level (Hm) and/or the vertical space dividing level (Vn) is. For example, FIG. 3 shows a case in which the vertical space dividing level (Vn) is two and the overall handwritten signature block is divided into 22 segment blocks, FIG. 4 shows a case where the horizontal space dividing level (Hm) is two and the overall handwritten signature block is divided into 22 segment blocks, and FIG. 5 shows a case where both the vertical space dividing level (Vn) and the horizontal space dividing level (Hm) are two and the overall handwritten signature block is divided into 22+2 segment blocks.

    [0027] FIG. 1 is a block diagram of a handwritten signature authentication system based on dynamic movement tracking of spatial-division segment blocks according to an embodiment of the present disclosure.

    [0028] Referring to FIG. 1. the handwritten signature authentication system based on dynamic movement tracking of spatial-division segment blocks according to an embodiment of the present disclosure may include an enrollment unit 100, a handwritten signature input unit 400, and a handwritten signature authentication unit 500, and may further include an input unit 200 and an output unit 300.

    [0029] The enrollment unit 100 may be set up in a variety of storage media including a hard drive of a personal computer (PC) or a laptop computer, a portable hard drive such as a universal serial bus (USB) device, a security token, a subscriber identification module (SIM) card embedded in a mobile device such as a cell phone or a smartphone, a micro SD card in the mobile device, a TrustZone in the mobile device, and an online hard drive. The enrollment unit 100 stores handwritten signature characteristics information (Σ).

    [0030] The handwritten signature characteristics information (Σ) includes overall hand-written signature block characteristics information (Q), overall segment block characteristics information (V), and overall segment block correlation characteristics information (C). Detailed information included in these types of information will be described more fully with reference to FIGS. 2 to 6 below.

    [0031] The input unit 200 may be a key input device that has numerous keys generating multiple commands and outputs key data (key signals) on pressed keys, a touchpad that also functions as a screen and outputs position data on touch points, and a receiver that receives data from an external device through wired and wireless communications. The input unit 200 sends commands such as a handwritten signature enrollment command and a handwritten signature authentication command upon request of a user to the handwritten signature authentication unit 500. If the handwritten signature authentication unit 500 is configured in the form of a server, the input unit 200 may also be a point-of-sale (POS) terminal, payment terminal, or mobile communication terminal from a remote place.

    [0032] The output unit 300 allows the handwritten signature authentication unit 500 to output a handwritten signature image, the handwritten signature characteristics information, and handwritten signature verification result. In case that the handwritten signature authentication unit 500 is configured in a mobile communication terminal, the output unit 300 may be a display device such as a liquid crystal display (LCD). In case that the handwritten signature authentication unit 500 is configured to be a server, the output unit 300 may be a message transmission server that transmits a mobile communication message containing a handwritten signature verification result such as a short message service (SMS) message, a long message service (LMS) message, a multimedia message service (MMS) message, an application server that transmits a push message, an e-mail server, or a mobile communication terminal that receives and displays the verification result.

    [0033] The handwritten signature input unit 400 may be configured in a terminal unit that receives a handwritten signature, such as a PC, mobile communication terminal, POS terminal, or payment terminal owned by a user or a service provider. Also, the hand-written signature input unit 400 may be a separate device capable of being connected to a separate device and output handwritten signature input data to acquire an image of the handwritten signature written by the user and may include at least one of a scan unit 410 and a touch input unit 420. It is recommended, however, to ensure that it includes a touch input unit 420 as it should receive input of a signature in a handwritten form. The touch input unit 420 may be a touchpad, touch screen, or smart pen, which enables to track a handwritten signature and collect image characteristics information of handwritten signature and segments, and behavioral characteristics information.

    [0034] The scan unit 410 scans a paper on which a signature is handwritten and sends scanned data to the handwritten signature authentication unit 500.

    [0035] The touch input unit 420 may be a touchpad or a touch screen and sends touch data that includes continuous position data and pressure data on a signature handwritten by a user to the handwritten signature authentication unit 500 as input data.

    [0036] The handwritten signature authentication unit 500 includes a control unit 510, a handwritten signature characteristics extraction unit 520, and a handwritten signature segment block authentication unit 560.

    [0037] The handwritten signature authentication unit 500 may be configured based on an application in a mobile communication terminal or a computer, based on an application or a web server in a server, or in the form of firmware in a POS or payment terminal. The configuration of an application server, web server, and firmware based on an application, firmware, or web server according to the present invention will not be further described in detail as it is obvious to those skilled in the art.

    [0038] To describe the configuration and operation of the handwritten signature authentication unit 500 in more detail, the control unit 510 controls overall operation of the handwritten signature authentication unit 500. In particular, the control unit 510 determines whether the command received from the input unit 200 is for handwritten signature enrollment or authentication, controls the operation of enrollment or authentication depending on the command, and sends the control results to the output unit 300.

    [0039] The handwritten signature characteristics extraction unit 520 extracts and outputs the handwritten signature characteristics information (Σ) based on the spatial-division segment block from the handwritten signature input data entered through the touch input unit 420 of the handwritten signature input unit 400.

    [0040] In detail, the handwritten signature characteristics extraction unit 520 includes a handwritten signature tracking unit 530, a handwritten signature image acquisition unit 540, and a handwritten signature characteristics acquisition unit 550.

    [0041] The handwritten signature tracking unit 530 detects continuous position data from the touch data from the touch input unit 420 of the handwritten signature input unit 400 and sends it to the handwritten signature image acquisition unit 540.

    [0042] The handwritten signature image acquisition unit 540 receives the scan data from the handwritten signature input unit 400 or the position data from the handwritten signature tracking unit 530, and acquires and outputs a handwritten signature image from the scan data or the position data.

    [0043] The handwritten signature image acquisition unit 540 may acquire a tracked handwritten signature image from the scan unit 410 or may generate the tracked hand-written signature image by tracking the position data entered in real time through the touch input unit 420 and the handwritten signature tracking unit 530.

    [0044] After the handwritten signature image is acquired through the handwritten signature image acquisition unit 540 and the overall handwritten signature block including the handwritten signature image is generated, the handwritten signature characteristics acquisition unit 550 divides the overall handwritten signature block into a predetermined number of a certain spatial units to generate the handwritten signature segments and generates handwritten signature segment images for the handwritten signature segments.

    [0045] In addition, the handwritten signature characteristics acquisition unit 550 generates blocks (hereinafter, referred to as "segment blocks") of a polygon (hereinafter, assumed to be a rectangle) for each of the generated handwritten signature segment images, extracts overall segment block characteristics information (V) on the generated segment blocks, generates an overall handwritten signature block (S) for an entire handwritten signature image entered through the handwritten signature image acquisition unit 540 or acquired by the handwritten signature image acquisition unit 540 itself, generates overall handwritten signature block characteristics information (Q) on the overall handwritten signature block, generates overall segment block position information (P) including block position information of each of the generated segment blocks

    [0046] (i.e. including sub-segment block position information), generates overall segment block correlation characteristics information (C) based on correlations between the segment blocks, generates segment dynamic behavioral characteristics information (ψi) of each spatial-division segment (si) and overall segment dynamic behavioral characteristics information (Ψ), generates segment transition dynamic behavioral characteristics information (ti) between the spatial-division segments and overall segment transition dynamic behavioral characteristics information (T), and generates and outputs the hand-written signature characteristics information (Σ) that includes the overall handwritten signature block characteristics information (Q), the overall segment block characteristics information (V), the overall segment block position information (P) including the sub-segment block position information, the overall segment block correlation characteristics information (C), the overall segment dynamic behavioral characteristics information (Ψ), and the overall segment transition dynamic behavioral characteristics information (T), as shown in Equation 1 below. Depending on implementations, the handwritten signature characteristics information (Σ) may include only the overall handwritten signature block characteristics information (Q), the overall segment block characteristics information (V), the overall segment block position information (P) including the sub-segment block position information, and the overall segment block correlation characteristics information (C), or may further include the overall segment dynamic behavioral characteristics information (Ψ) and the overall segment transition dynamic behavioral characteristics information (T) as shown in Equation 1 below.



    [0047] The detailed configuration of the handwritten signature characteristics acquisition unit 550 will be described below with reference to FIGS. 2, 7, and 8.

    [0048] Upon receiving the handwritten signature authentication command from the control unit 510, the handwritten signature segment block authentication unit 560 receives signer's identification information from the handwritten signature input unit 400 and the handwritten signature characteristics information (Σ) from the handwritten signature characteristics extraction unit 520, loads pre-enrolled handwritten signature characteristics information (Σ') corresponding to the signer identification information from the enrollment unit 100, compares the loaded pre-enrolled handwritten signature characteristics information (Σ') with the handwritten signature characteristics information (Σ) entered from the handwritten signature characteristics extraction unit 520 to determine whether they match beyond a predetermined matching level.

    [0049] To be more specific, the handwritten signature segment block authentication unit 560 compares the enrolled overall block characteristics information (Q') of the loaded enrolled handwritten signature characteristics information (Σ') with the overall handwritten signature block characteristics information (Q) of the handwritten signature characteristics information (Σ) extracted through the handwritten signature characteristics extraction unit 520, compares the enrolled overall segment block characteristics information (V') with the extracted overall segment characteristics information (V), compares the enrolled overall segment block position information (P') including the sub-segment block position information with the extracted overall segment block position information (P) including the sub-segment block position information, compares the enrolled overall segment block correlation characteristics information (C') with the extracted overall segment block correlation characteristics information (C), compares the enrolled overall segment dynamic behavioral characteristics information (Ψi') with the extracted overall segment dynamic behavioral characteristics information (Ψi), and compares the enrolled overall segment transition dynamic behavioral characteristics information (Ti') with the extracted overall segment transition dynamic behavioral characteristics information (Ti) to perform the handwritten signature authentication by determining whether the match rates of the above comparisons respectively reach predetermined matching levels.

    [0050] FIG. 2 is a block diagram of the handwritten signature characteristics acquisition unit in the handwritten signature authentication system based on dynamic movement tracking of spatial-division segment blocks according to an embodiment of the present disclosure, FIG. 3 illustrates a method of generating the segment blocks of the handwritten signature along with characteristics information elements of the segment blocks according to a first embodiment of the present disclosure, FIG. 4 illustrates a method of generating the segment blocks of the handwritten signature along with characteristics information elements of the segment blocks according to a second embodiment of the present disclosure, FIG. 5 illustrates a method of generating the segment blocks of the handwritten signature along with characteristics information elements of the segment blocks according to a third embodiment of the present disclosure, and FIG. 6 illustrates a method of generating the sub-segment blocks of the handwritten signature and detecting patterns of the sub-segment blocks according to a first embodiment of the present disclosure, and characteristics information elements of the sub-segment blocks. The configuration and operation of the handwritten signature characteristics acquisition unit 550 will be described in detail with reference to FIGS. 2 to 6.

    [0051] The handwritten signature characteristics acquisition unit 550 includes a hand-written signature start detection unit 610, a handwritten signature end detection unit 620, a spatial-division segment detection unit 630, a segment count unit 640, a spatial-division segment block characteristics detection unit 650, an overall handwritten signature block characteristics detection unit 660, a sub-segment block correlation detection unit 670, and a handwritten signature characteristics information generation unit 680. Depending on embodiments, the handwritten signature characteristics acquisition unit 550 may further include a dynamic movement tracking unit 690.

    [0052] The handwritten signature start detection unit 610 receives continuous handwritten signature input data from the touch input unit 400 while the signer handwrites a signature on the touch input unit 420 of the handwritten signature input unit 400 as shown in FIG. 3.

    [0053] When the handwritten signature input data starts to be input, the handwritten signature start detection unit 610 detects a start point (3) of the handwritten signature as shown in FIG. 3. The start point (3) may be a start point of a first handwritten signature segment.

    [0054] The handwritten signature start detection unit 610 outputs handwritten signature start point information and first segment start point information, and sends a handwritten signature start point detection signal to the spatial-division segment detection unit 630.

    [0055] If the handwritten signature input data is not entered through the touch input unit 420 for a certain period of time, the handwritten signature end detection unit 620 detects and determines the end point of the handwritten signature corresponding to the final touch data input point, namely Point (5) in FIG. 3, as the end point of the handwritten signature, and outputs the determined end point information of the handwritten signature.

    [0056] After receiving the handwritten signature start point detection signal from the handwritten signature start detection unit 610 and the handwritten signature end point detection signal from the handwritten signature end detection unit 620, the spatial-division segment detection unit 630 generates the entire handwritten signature image and the overall handwritten signature block.

    [0057] When overall handwritten signature block is generated, the spatial-division segment detection unit 630 vertically divides the overall handwritten signature block by a preset dividing level (m) to obtain 2m segment blocks of equal sizes as shown in FIG. 3, horizontally divides the overall handwritten signature block by a preset dividing level (m) to obtain 2m segment blocks of equal sizes as shown in FIG. 4, or divides the overall handwritten signature block vertically by a preset dividing level (I) and then horizontally by a preset dividing level (m) to obtain 2lx2m=2(l+m) segment blocks of equal sizes as shown in FIG. 5. In other words, the spatial-division segment detection unit 630 divides the overall handwritten signature block by a certain space unit to generate the segment blocks of the same sizes.

    [0058] While generating the segment blocks, the spatial-division segment detection unit 630 detects a top position (topi), a bottom position (bottomi), a leftmost position (lefti), and a rightmost position (righti) of each segment block at which the segment block meets the segment image as shown in FIGS. 3-6, and stores position information of the detected points as segment block characteristics information. Since the segment block 2 is divided spatially according to the present disclosure, there may be a plurality of top positions (topi), bottom positions (bottomi), leftmost positions (lefti), or rightmost positions (righti) or there may be no such point at each side of the segment block as shown in FIGS. 3-6. Here, if there are a plurality of such points at a side of the segment block, the information on the number of the points may be used as characteristics information of the segment block.

    [0059] Meanwhile, in case that there is no such point on a side, the spatial-division segment detection unit 630 may determine a position corresponding to a segment image position closest to the side at which the point does not exist as a virtual point, and use information of a distance between a position in the segment image and the virtual position of the side of the segment block 2 as the characteristics information of the segment block.

    [0060] In FIG. 3, for example, a second segment block (2-2) has four leftmost positions (left1) and three rightmost positions (right1). At this time, the number of leftmost positions, i.e. four, and the number of leftmost positions, i.e. three, may be used as the characteristics information of the second segment block.

    [0061] Also, though the second segment block (2-2) has no bottom position (bottom1), the position of a leftmost position (left13) corresponding to a segment image position closest to the lower side of the segment block (2-2) may be set as the bottom position (bottom1), and stored together with information of a distance (dbottom1) from the lower side to the point. As described above, the distance information may be used as the characteristics information of the second segment block (2-2).

    [0062] Also, the spatial-division segment detection unit 630 counts a number (n) of the segment blocks.

    [0063] Also, for each of the generated segment blocks, the spatial-division segment detection unit 630 loads touch data of the segment block and tracks the touch data to detect and output a handwritten signature image in the segment block (hereinafter referred to 'segment image').

    [0064] The spatial-division segment detection unit 630 outputs a sub-segment detection signal to the segment count unit 640 whenever a new segment is detected.

    [0065] Referring to FIGS. 3-6, for example, the spatial-division segment detection unit 630 detects the entire handwritten signature image after the signer initiates the hand-written signature and completes the handwritten signature, and generates the overall handwritten signature block (1) containing the generated entire handwritten signature image.

    [0066] When the overall handwritten signature block (1) is generated, the spatial-division segment detection unit 630 finds a midpoint in the direction of x-axis, divides the overall handwritten signature block (1) into two blocks based on a center line passing through the midpoint in the direction of the x-axis (referred to as "first dividing"), and further divides each of the divided blocks into two blocks based on a midpoint in the direction of the x-axis of the divided block (referred to as "second dividing"). Accordingly, depending on the dividing level (m), 2m segment blocks are generated.

    [0067] The spatial-division segment detection unit 630 outputs start point information of the start point (3) and end point information of the end point (5) of each of the detected segments.

    [0068] In the example shown in FIG. 3 where the dividing level (m) is two, the spatial-division segment detection unit 630 detects four handwritten signature segments and outputs a detection signal whenever a sub-segment is detected from the detected handwritten signature segments.

    [0069] Also, the spatial-division segment detection unit 630 detects sub-segment images in the segment blocks and outputs the sub-segment images to the spatial-division segment block characteristics detection unit 650.

    [0070] The segment count unit 640 counts the number (m) of the sub-segments each time the sub-segment detection signal is received from the spatial-division segment detection unit 630 and outputs the count number (m) information. Since the segment block (2-1) shown in FIGS. 3 and 6 includes five sub-segment images, the segment count unit 640 outputs five as the counted number (m) information of the sub-segments.

    [0071] When a segment block and segment image are received from the spatial-division segment detection unit 630, the spatial-division segment block characteristics detection unit 650 generates segment block characteristics information (vi) and sub-segment block characteristics information (v́i). The spatial-division segment block characteristics detection unit 650 generates and outputs the overall segment block characteristics information (V) after the segment block characteristics information (vi) and the sub-segment block characteristics information (v́i) are acquired for all the segments of the handwritten signature. The detailed configuration and operation of the spatial-division segment block characteristics detection unit 650 will be described below with reference to FIG. 4.

    [0072] The segment blocks may have a form of a various shapes of polygon, such as a rectangle and a pentagon, however, it is recommended that the segment blocks are rectangular-shaped as shown in FIGS. 3-6, so that the same rule may be applicable in generating and describing all the segments of the handwritten signature.

    [0073] The rectangular segment block (2) according to the present disclosure is divided into spatial units of the same sizes.

    [0074] The spatial-division segment block characteristics detection unit 650 detects the top position (topi), the bottom position (bottomi), the leftmost position (lefti), and the rightmost position (righti) of the segment image formed in each of the generated segment blocks (2).

    [0075] The overall handwritten signature block characteristics detection unit 660 generates and outputs the overall handwritten signature block characteristics information (Q) from the overall handwritten signature block (S) including all the handwritten signature images acquired from the handwritten signature image acquisition unit 540 or the spatial-division segment detection unit 630. The overall handwritten signature block characteristics information (Q) includes position data of four corners [{(X0, Y0), (X1, Y1), (X2, Y2), (X3, Y3)}] of the overall handwritten signature block (S) and overall handwritten signature block space information (space(S)) as shown in Equation 2.



    [0076] The sub-segment block correlation detection unit 670 receives the segment block characteristics information (vi) and the sub-segment block characteristics information (vi) from the spatial-division segment block characteristics detection unit 650 and receives the overall handwritten signature block space information (space(S)) of the overall handwritten signature block (1) from the overall handwritten signature block characteristics detection unit 660. The sub-segment block correlation detection unit 670 generates and outputs overall segment block correlation characteristics information (C), for each segment block (si), including correlation information between each sub-segment block (śi.x) and one or more of its adjacent segment sub-blocks (si.y) and correlation information between the segment block and the overall handwritten signature segment block.

    [0077] The handwritten signature characteristics information generation unit 680 receives the overall segment block characteristics information (V) from the spatial-division segment block characteristics detection unit 650, receives the overall handwritten signature block characteristics information (Q) from the overall handwritten signature block characteristics detection unit 660, receives the overall segment block correlation characteristics information (C) from the sub-segment block correlation detection unit 670, and generates and outputs the handwritten signature characteristics information (Σ) including the overall segment block characteristics information (V), the overall handwritten signature block characteristics information (Q), and the overall segment block correlation characteristics information (C).

    [0078] In case that the dynamic movement tracking unit 690 is equipped in the handwritten signature characteristics acquisition unit 550, the spatial-division segment detection unit 630 generates and outputs dynamic movement point information (αi) every time the touch data is input when the handwritten signature start point detection signal is input from the handwriting signature start detection unit 610.

    [0079] In such a case, the dynamic movement tracking unit 690 calculates the segment dynamic behavioral characteristics information (ψi) from the dynamic movement point information (αi) and the spatial-division segment block information (si) and generates the overall segment dynamic behavioral characteristics information (Ψ) and the overall segment transition dynamic behavioral characteristics information (T) to output to the handwritten signature characteristics information generation unit 680. The detection of the dynamic movement point information (αi) in the spatial-division segment detection unit 630 and the generation of the dynamic behavioral characteristics information (ψi), the overall segment dynamic behavioral characteristics information (Ψ), the segment transition dynamic behavioral characteristics information (ti), and the overall segment transition dynamic behavioral characteristics information (T) in the dynamic movement tracking unit 690 will be described below in detail.

    [0080] FIG. 7 is a block diagram of the spatial-division segment block characteristics detection unit in the handwritten signature characteristics acquisition unit 550 according to an embodiment of the present disclosure.

    [0081] The spatial-division segment block characteristics detection unit 650 includes a sub-segment block generation unit 651, a segment block position detection unit 652, a segment block space characteristics detection unit 653, a space ratio characteristics detection unit 654, and a segment block characteristics information generation unit 655.

    [0082] The sub-segment block generation unit 651 receives the segment block (si) and the segment image, detects an image that may be disjointed from the segment image or is cut by the segment blocks (hereinafter, referred to as "sub-segment image"), and generates the sub-segment block (śi.x) including the sub-segment image to output the segment image, the segment block (si), the sub-segment image, and the sub-segment block (śi.x) to the segment block position detection unit 652, the segment block space characteristics detection unit 653, and the segment block characteristics information generation unit 655.

    [0083] In case that the segment block (si) contains two or more sub-segment images that may be disjointed from each other like a first segment block (2-1) of FIG. 6, the sub-segment block generation unit 651 generates a sub-segment block (2-1-1), sub-segment block (2-1-2), sub-segment block (2-1-3), sub-segment block (2-1-4), and sub-segment block (2-1-5).

    [0084] Upon receiving the segment block (si) and the sub-segment block (śi.x) from the sub-segment block generation unit 651, the segment block position detection unit 652 detects and outputs segment block position information (pi) and sub-segment block position information (ṕi.x) for each of the edges of the segment block (si) and the sub-segment block (śi.x), respectively. In case of a rectangular segment block, the segment block position information (pi) may be expressed by Equation 3.



    [0085] Also, the segment block position detection unit 652 may further output the sub-segment block (śi.x) as shown in FIG. 6, where 'i' denotes an index for the segment block, 'x' denotes an index for the sub-segment block, and therefore 'śi.x' denotes an x-th sub-segment of an i-th segment. Also, the segment block position detection unit 652 may further output the sub-segment block position information (ṕi.x) for the sub-segment block (śi.x).

    [0086] In case that the block is rectangular-shaped, the sub-segment block position information (ṕi.x) may be expressed by Equation 4.



    [0087] Thus, in case that the block is rectangular-shaped, the overall sub-segment block position information (ṕi) for the sub-segment block (śi.x) may be expressed by Equation 5.



    [0088] Therefore, overall segment block position information (P) for the entire handwritten signature, that is, for the entire segments may be expressed by Equation 6.



    [0089] In case where the segment block includes five sub-segment blocks as in the case of the first segment block (2-1) shown in FIG. 6, the segment block position detection unit 652 may further generate pattern information of a pattern (6-1) based on the sub-segment block position information (ṕi.x). The pattern information may be stored in the form of the sub-segment block position information (ṕi.x) or in the form of image data corresponding to the pattern.

    [0090] The segment block space characteristics detection unit 653 calculates space areas of the segment blocks (si) received from the sub-segment block generation unit 651 and outputs segment block space information (space(si)).

    [0091] Also, the segment block space characteristics detection unit 653 may further calculate space areas of the sub-segment blocks (śi.x) ('x' denotes an index corresponding to the number of the sub-segment blocks) received from the sub-segment block generation unit 651 and generate sub-segment block space information (space(śi.x)). The segment block space characteristics detection unit 653 may output the sub-segment block space information (space(śi.x)) along with the segment block space information (space(si)) or separately from the segment block space information (space(si)).

    [0092] The space ratio characteristics detection unit 654 receives the segment block space information (space(si)) and the sub-segment block space information (space(śi.x)) from the segment block space characteristics detection unit 653, receives the overall handwritten signature block space information (space(S)) from the overall handwritten signature block characteristics detection unit 660, and calculates and outputs information of a ratio (Δi) of the segment block space to the overall handwritten signature block space, information of a ratio (Δ́i.x) of the sub-segment block space to the overall handwritten signature block space, and information of a ratio (έi.x) of the sub-segment block space to the segment block space.

    [0093] In other words, in case that there exist a plurality of sub-segment blocks (śi.x) in one segment block (s0)(2-1), where i=0, x=0, 1, 2, 3, 4, as shown in FIGS. 3 and 6, the space ratio characteristics detection unit 654 may calculate and output the information of the ratio (Δ́i.x) of the sub-segment block space to the overall handwritten signature block space, and the information of the ratio (έi.x) of the sub-segment block space to the segment block space..

    [0094] The segment block characteristics information generation unit 655 receives the segment block position information (pi) and the sub-segment block position information (ṕi.x) from the segment block position detection unit 652, receives the segment block space information (space(si)) and the sub-segment block space information (space(śi.x)) from the segment block space characteristics detection unit 653, and receives the information of the ratio (Δi) of the segment block space to the overall handwritten signature block space, the information of the ratio (Δ́i.x) of the sub-segment block space to the overall handwritten signature block space, and the information of the ratio (έi.x) of the sub-segment block space to the segment block space to generate the segment block characteristics information (vi). After the segment block characteristics information (vi) is generated for all the segment blocks, the segment block characteristics information generation unit 655 generates and outputs the overall segment block characteristics information (V).

    [0095] The segment block characteristics information (vi) may be expressed by Equation 7.



    [0096] In case that there exist a plurality of sub-segment blocks (śi.x) in one segment block (s0)(2-1) as shown in FIGS. 3 and 6, the segment block characteristics information generation unit 655 may further include the information of the ratio (Δ́i.x) of the sub-segment block space to the overall handwritten signature block space and the information of the ratio (έi.x) of the sub-segment block space to the segment block space in the overall segment block characteristics information (V).

    [0097] Here, sub-segment block characteristics information (v́i.x) for each of the sub-segment blocks and a set of the sub-segment block characteristics information (v́i) may be expressed by Equation 8.



    [0098] Also, the overall segment block characteristics information (V) may be expressed by Equation 9.



    [0099] FIG. 8 is a block diagram of a sub-segment block correlation detection unit in the handwritten signature characteristics acquisition unit according to an embodiment of the present disclosure. Also, FIG. 9 illustrates a method of generating an inclusion relation of sub-segment blocks which is one of correlation information between the segment blocks according to an embodiment of the present disclosure, FIG. 10 illustrates a method of generating a positional relation of sub-segment blocks which is one of correlation information between the segment blocks to according an embodiment of the present disclosure, and FIG. 11 illustrates a method of generating a positional relation of sub-segment blocks which is one of correlation information between the segment blocks according to an embodiment of the present disclosure. FIG. 12 illustrates an exemplary handwritten signature authentication method according to an embodiment of the present disclosure.

    [0100] The sub-segment block correlation detection unit 670 includes an intersection space detection unit 671, an intersection space ratio detection unit 672, a sub-segment block inclusion relation detection unit 673, a sub-segment block positional relation detection unit 674, a sub-segment block edge positional relation detection unit 675, and a correlation characteristics information generation unit 677.

    [0101] The intersection space detection unit 671 receives sub-segment block (śi.x) from the spatial-division segment block characteristics detection unit 650, and analyzes received sub-segment block (śi.x) and one or more of adjacent sub-segment blocks (śi.y) to check whether there is an intersection space between the received sub-segment block (śi.x) and the adjacent sub-segment blocks (śi.y). If there is any intersection space between the received sub-segment block (śi.x) and the adjacent sub-segment blocks (śi.y), the intersection space detection unit 671 calculates a size of the intersection space between the received sub-segment block (śi.x) and the adjacent sub-segment blocks (śi.y) and generates and outputs intersection space information (δ́i.xy).

    [0102] In the examples shown in FIGS. 3 and 6, the intersection space detection unit 671 checks whether there is an intersection space between a sub-segment block (ś0.0)(2-1-1) and an adjacent sub-segment block (ś0.1)(2-1-2) in the segment block (s0). Since there is an intersection space between the sub-segment block (ś0.0)(2-1-1) and the adjacent sub-segment block (ś0.1)(2-1-2), the intersection space detection unit 671 calculates the size of the intersection space between the sub-segment block (ś0.0)(2-1-1) and the adjacent sub-segment block (ś0.1)(2-1-2) and outputs the intersection space information (δ́0.01).

    [0103] Similarly, since there is an intersection space between the sub-segment block (ś0.1) and the adjacent sub-segment block (ś0.2), the intersection space detection unit 671 calculates the size of the intersection space between the sub-segment block (ś0.1) and the adjacent sub-segment block (ś0.2) and outputs the intersection space information (δ́0.12).

    [0104] In the same manner, the intersection space detection unit 671 calculates the size of the intersection space between the sub-segment block (ś0.2) and the adjacent sub-segment block (ś0.3) to output the intersection space information (δ0.23), and calculates the size of the intersection space between the sub-segment block (ś0.3) and the adjacent sub-segment block (ś0.4) to output the intersection space information (δ́0.34).

    [0105] The intersection space ratio detection unit 672 receives the segment block space information (space(si)) and the sub-segment block space information (space(śi.x)) from the segment block space characteristics detection unit 653 of the segment block characteristics detection unit 650, receives the overall handwritten signature block space information (space(S)) from the overall handwritten signature block characteristics detection unit 660, receives the intersection space information (δ́i.xy) from the intersection space detection unit 671, and generates and outputs intersection space ratio information. The intersection space ratio information includes information of a ratio of the sub-segment block intersection space to the sub-segment block space (π́i(δ́ij)), information of a ratio of the sub-segment block intersection space to an adjacent sub-segment block space (π́j(δ́ij)), information of a ratio of the sub-segment block intersection space to the overall handwritten signature block space (ŕi.xy), which are calculated as follows:







    [0106] In addition, the intersection space ratio detection unit 672 may further calculate a ratio of the segment block space (space(si)) to the overall handwritten signature block (S) and output overall handwritten signature space ratio information.

    [0107] The segment block inclusion relation detection unit 673 determines an inclusion relation between the sub-segment block (śi.x) and the adjacent sub-segment block (śi.y) and outputs sub-segment block inclusion relation information (ói.xy) according to a determination result. The sub-segment block inclusion relation information that is stored according to the present disclosure may have one of three states: inclusion (IN), non-inclusion (exclusion)(EX), and intersection (INTER). When the adjacent sub-segment block (śi.y) is included in the sub-segment block (śi.x) as shown in FIG. 9(A), the sub-segment block inclusion relation detection unit 673 generates the sub-segment block inclusion relation information having a state indicating "inclusion (IN)." When the adjacent sub-segment block (śi.y) is located outside the sub-segment block (śi.x) as shown in FIG. 9(B), the sub-segment block inclusion relation detection unit 673 generates the sub-segment block inclusion relation information having a state indicating "non-inclusion (EX)." When the adjacent sub-segment block (śi.y) partially or totally intersects the sub-segment block (śi.x) as shown in FIG. 9(C), the sub-segment block inclusion relation detection unit 673 generates the sub-segment block inclusion relation information having a state indicating "intersection (INTER)."

    [0108] The sub-segment block positional relation detection unit 674 generates and outputs sub-segment block positional relation information (pósi.xy) which represents position information of the adjacent sub-segment block (śi.y) with respect to the sub-segment block (śi.x).

    [0109] Examples of positional relations of the sub-segment blocks are illustrated in FIG. 10. When the adjacent sub-segment block (śi.y) is located to the right of the sub-segment block (śi.x) as shown in FIG. 10(A), the sub-segment block positional relation detection unit 674 generates and outputs the sub-segment block positional relation information (pósi.xy) of "R" representing a right side. When the adjacent sub-segment block (śi.y) is located to the left of the sub-segment block (śi.x) as shown in FIG. 10(B), the sub-segment block positional relation detection unit 674 outputs the sub-segment block positional relation information (pósi.xy) of "L" representing a left side. When the adjacent sub-segment block (śi.y) is located above the sub-segment block (śi.x) as shown in FIG. 10(C), the sub-segment block positional relation detection unit 674 outputs the sub-segment block positional relation information (pósi.xy) of "U" representing upside. When the adjacent sub-segment block (śi.y) is located below the sub-segment block (śi.x) as shown in FIG. 10(D), the sub-segment block positional relation detection unit 674 outputs the sub-segment block positional relation information (pósi.xy) of "D" representing downside.

    [0110] The sub-segment block edge positional relation detection unit 675 receives intersection information between the sub-segment block (śi.x) the adjacent sub-segment block (śi.y) from the intersection space ratio detection unit 672. In case that the sub-segment block (śi.x) intersects the adjacent sub-segment block (śi.y), the sub-segment block edge positional relation detection unit 675 determines which edge of the sub-segment block (śi.x) intersects the adjacent sub-segment block (śi.y), and outputs sub-segment block edge positional relation information (ed́gei.xy) that represents the edge of the sub-segment block (śi.x) intersecting the adjacent sub-segment block (śi.y).

    [0111] Examples of the sub-segment block positional relations between sub-segment blocks are illustrated in FIG. 11. When the adjacent sub-segment block (śi.y) is located in a down-left position of the sub-segment block (śi.x) and the left and bottom edges of the sub-segment block (śi.x) intersects the adjacent sub-segment block (śi.y) as shown in FIG. 11(A), the sub-segment block edge positional relation detection unit 675 outputs the sub-segment block edge positional relation information (ed́gei.xy) of {L, D} which represents that the left and bottom edges of the segment block (si) intersects the adjacent sub-segment block (śi.y).

    [0112] When an adjacent segment block (sj) is located in an up-right position of the sub-segment block (śi.x) and the right and top edges of the sub-segment block (śi.x) intersects the adjacent sub-segment block (śi.y) as shown in FIG. 11(B), the sub-segment block edge positional relation detection unit 675 outputs the sub-segment block edge positional relation information (ed́gei.xy) of {R, U}.

    [0113] When the adjacent sub-segment block (śi.y) is located in a downward position of the sub-segment block (śi.x) and the left, right, and bottom edges of the sub-segment block (śi.x) intersects the adjacent sub-segment block (śi.y) as shown in FIG. 11(C), the sub-segment block edge positional relation detection unit 675 outputs the sub-segment block edge positional relation information (ed́gei.xy) of {L, R, D}.

    [0114] When the adjacent sub-segment block (śi.y) is located in a upward position of the sub-segment block (śi.x) and the left, right, and top edges of the sub-segment block (śi.x) intersects the adjacent sub-segment block (śi.y) as shown in FIG. 11 (D), the sub-segment block edge positional relation detection unit 675 outputs the sub-segment block edge positional relation information (ed́gei.xy) of {L, R, U}.

    [0115] The correlation characteristics information generation unit 677 receives the intersection space ratio information, the sub-segment block inclusion relation information (ói.xy), the sub-segment block positional relation information (pósi.xy), and the sub-segment block edge positional relation information (ed́gei.xy) from the intersection space ratio detection unit 672, the sub-segment block inclusion relation detection unit 673, the sub-segment block positional relation detection unit 674, and the sub-segment block edge positional relation detection unit 675, respectively, and generates correlation characteristics information (ći.xy) including those information. After the correlation characteristics information (ći.xy) is generated for all segment blocks, the correlation characteristics information generation unit 677 generates and outputs overall segment block correlation characteristics information (C).

    [0116] The correlation characteristics information (ći.xy) and the overall segment block correlation characteristics information (C) may be expressed by Equations 10 and 11,

    respectively.



    [0117] FIG. 12 is a flowchart illustrating a handwritten signature authentication method based on dynamic movement tracking of spatial-division segment blocks according to an embodiment of the present disclosure.

    [0118] Referring to FIG. 12, the control unit 510 monitors whether handwritten signature enrollment is requested by a command for handwritten signature enrollment through the input unit 200 (S111) or whether handwritten signature authentication is requested by a command for handwritten signature authentication (S113).

    [0119] When the handwritten signature enrollment is requested, the control unit 510 requests the input of the signer's identification information (S115) and monitors whether the signer identification information is entered (S117).

    [0120] After the signer identification information is entered, the control unit 510 requests the signer to handwrite a signature (S118).

    [0121] Afterwards, the control unit 510 collects spatial-division segment block based handwritten signature characteristics information (Σ) by performing a spatial-division segment block based handwritten signature characteristics information acquisition routine (S119), maps the collected spatial-division segment block based handwritten signature characteristics information (Σ) to the signer identification information, and stores the collected spatial-division segment block-based handwritten signature characteristics information (Σ) in the enrollment unit 100 (S121).

    [0122] On the other hand, when the handwritten signature authentication is requested, the control unit 510 requests the input of the signer's identification information (S123) and monitors whether the signer identification information is entered (S125).

    [0123] After the signer identification information is entered, the control unit 510 requests the signer to handwrite a signature through the output unit 300 (S126).

    [0124] Afterwards, the control unit 510 collects spatial-division segment block based handwritten signature characteristics information (Σ) by performing a spatial-division segment block-based handwritten signature characteristics information acquisition routine through the handwritten signature characteristics extraction unit 520 (S127), loads, from the enrollment unit 100, the enrolled handwritten signature characteristics information (Σ') that corresponds to the input signer identification information through a handwritten signature segment block authentication unit 560 (S129).

    [0125] After the enrolled handwritten signature characteristics information (Σ') is loaded, the control unit 510 compares the enrolled handwritten signature characteristics information (Σ') with the received handwritten signature characteristics information (Σ) through the handwritten signature segment block authentication unit 560 (S131). The control unit 510 may further compare enrolled handwritten signature behavioral characteristics information with collected handwritten signature behavioral characteristics information.

    [0126] The control unit 510 determines, through the handwritten signature segment block authentication unit 560, whether the match rate for each characteristics item reaches a predetermined match rate (S133). The control unit 510 conducts authentication success processing if the match rate is greater than or equal to the predetermined match rate (S135), and conducts authentication failure processing if the match rate is below the predetermined match rate (S137).

    [0127] FIG. 13 is a flowchart illustrating a method of collecting handwritten signature characteristics data in the handwritten signature authentication method based on dynamic movement tracking of spatial-division segment blocks according to an embodiment of the present disclosure.

    [0128] The control unit 510 monitors whether the touch data, which is the handwritten signature input data, begins to be entered from the touch input unit 420, through at least one of a handwritten signature tracking unit 530, a handwritten signature image acquisition unit 540, and a handwritten signature characteristics acquisition unit 550 (S211).

    [0129] When monitoring the input of the touch data is started, the control unit 510 performs a routine for detecting handwritten signature, segments, and sub-segments to detect the handwritten signature, the segments, the segment blocks, the sub-segments, and the sub-segment blocks. Also, the control unit 510 detects and stores information including the corresponding segment images, the sub-segment images, the handwritten signature image, the segment blocks, the sub-segment blocks, and the overall handwritten signature block (S) (S213). The routine for detecting the segments and sub-segments will be described below in detail with reference to FIG. 14.

    [0130] After the overall handwritten signature block, the handwritten signature image, the segment images, the segment blocks, the sub-segment images, and the sub-segment blocks are generated, the control unit 510 performs a handwritten signature dynamic movement characteristics information detection routine to detect the dynamic movement point information (αi) and generates and outputs the handwritten signature dynamic movement characteristics information (ψi, ψ) based on the dynamic movement point information (αi) (S260). The method of detecting the dynamic movement characteristics information will be described below with reference to FIG. 14.

    [0131] Simultaneously with the start of the detection operation of the handwritten signature dynamic movement characteristics information, the control unit 510 loads information of the number (n) of segment blocks and the number (m) of sub-segment blocks of each segment block through the spatial-division segment block characteristics detection unit 650 (S215).

    [0132] Also, the control unit 510 calculates space area of the overall handwritten signature block (S), the segment block (si), and the sub-segment block (śi.x) to generate the overall handwritten signature block space information (space(S)), the segment block space information (space(si)), and the sub-segment block space information (space(śi.x)) (S217).

    [0133] After the acquisition of the space information, the control unit 510 may calculate the ratio of the segment block space (space(si)) to the overall handwritten signature block space to generate the information of the ratio (Δi) of the segment block space to the overall handwritten signature block space.

    [0134] After the acquisition of the space information of the segment blocks and the sub-segment blocks, the control unit 510 initializes the segment block index (i), the sub-segment block index (x), and the adjacent sub-segment block index (y) (S219).

    [0135] After variables are initialized, the control unit 510 determines whether there is any sub-segment block in the current segment block (S220).

    [0136] In the case that there is no sub-segment block in the current segment block, the control unit 510 generates the segment block characteristics information (vi) (S221), increments the segment block index (i) by one, and performs again the operations after the operation S220.

    [0137] In the case that there is at least one sub-segment block in the current segment block, the control unit 510 calculates the information of the ratio (Δ́i.x) of the sub-segment block space to the overall handwritten signature block space and the information of the ratio (έi.x) of the sub-segment block space to the segment block space (S223).

    [0138] After the sub-segment block space ratio information is generated, the control unit 510 generates the segment block characteristics information (vi) and the sub-segment block characteristics information (v́i) (S225).

    [0139] After the segment block characteristics information (vi) and the sub-segment block characteristics information (v́i) are generated, the control unit 510 checks whether there is any adjacent segment block that forms the inclusion or intersection relationship with each of the segment blocks (S227).

    [0140] If there is an adjacent segment intersecting or being included in the segment block, the control unit 510 generates the intersection space information (δi.xy) by calculating space area of the inclusion space or the intersection space formed by the sub-segment block (śi.x) and the adjacent sub-segment block (śi.y) (S229).

    [0141] When the intersection space information (δi.xy) is generated, the control unit 510 generates the sub-segment block intersection space ratio information (π́j(δ́ij)), which is the ratio of the overlapping intersection space (δ́i.xy) to the sub-segment block space (śi.x) (S231).

    [0142] Furthermore, the control unit 510 generates the adjacent segment block intersection space ratio information (π́j(δ́ij)), which is the ratio of the overlapping intersection space (δ́i.xy) to the space (śi.y) of the adjacent sub-segment block forming the intersection space with the sub-segment block space (śi.x) (S232).

    [0143] The control unit 510 generates the sub-segment block inclusion relation information (ói.xy) that represents whether an adjacent sub-segment block (śi.y) is included in each sub-segment block (śi.x) or not, the sub-segment block positional relation information (pósi.xy) that represents relative position information of all adjacent sub-segment blocks(sj) with respect to the sub-segment block (śi.x), and the sub-segment block edge positional relation information (ed́gei.xy) that represents the edge of the sub-segment block (śi.x) intersecting the adjacent sub-segment block (śi.y) (S235, S237, and S239).

    [0144] When the correlation characteristics information for one sub-segment block and adjacent sub-segment blocks is generated as above, the control unit 510 determines whether the correlation characteristics information is generated for all the adjacent sub-segments included in the sub-segment block (S240).

    [0145] If there remains any adjacent sub-segment for which the correlation characteristics information is not generated yet, the control unit 510 increments the adjacent sub-segment index (y) by one (S243) and carries out the operation S223 and following operations to acquire the correlation characteristics information (ći.xy) for all the adjacent sub-segments in the sub-segment block.

    [0146] If the correlation characteristics information is acquired for all the adjacent sub-segments included in the sub-segment block, however, the control unit 510 checks whether the correlation characteristics information is acquired for all the sub-segment blocks of the handwritten signature (S241).

    [0147] If there remains any sub-segment block for which the generation of the correlation characteristics information is not completed, the control unit 510 increments the sub-segment block index (x) by one (S244), initializes the adjacent sub-segment block index (y) (i.e. y=0), and carries out the operation S223 and the following operations to acquire the correlation characteristics information (ći.xy) for all the adjacent sub-segments in the sub-segment block related with the handwritten signature.

    [0148] If the correlation characteristics information is acquired for all the adjacent sub-segments included in the segment block, however, the control unit 510 checks whether the correlation characteristics information is acquired for all the segment blocks of the handwritten signature (S245).

    [0149] If there remains any segment block for which the generation of the correlation characteristics information is not completed, the control unit 510 initializes the sub-segment block index (x) and the adjacent sub-segment block index (y) (i.e. x-0, y=0), increments the segment block index (i) by one (S247), and carries out the operation S220 and the following operations to acquire the correlation characteristics information (ći.xy) for all the sub-segment blocks in all the segment blocks related with the handwritten signature.

    [0150] When the correlation characteristics information are acquired for all the segment blocks, the control unit 510 generates the overall segment block characteristics information (V) and the overall segment block correlation characteristics information (C) (S249).

    [0151] When the overall segment block characteristics information and the overall segment block correlation characteristics information are acquired, the control unit 510 generates the handwritten signature characteristics information (Σ) including all the information described above to store in the enrollment unit 100 (S255).

    [0152] FIG. 14 is a flowchart illustrating a method of generating a spatial-division segment block according to an embodiment of the present disclosure.

    [0153] Referring to FIG. 14, the control unit 510 checks whether the handwritten signature is terminated through the handwritten signature end detection unit 620 and whether the handwritten signature image is acquired through the spatial-division segment detection unit 630 (S311).

    [0154] After the acquisition of the handwritten signature image, the control unit 510 generates the overall handwritten signature block (S313) and loads a spatial dividing level (n) (S315). The spatial dividing level may include only a vertical space dividing level (Vn) in case of performing only a vertical dividing, may include only a horizontal space dividing level (Hm) in case of performing only a horizontal dividing, and may include both the horizontal space dividing level (Hm) and the vertical space dividing level (Vn) in case where both the horizontal dividing and the vertical dividing is performed.

    [0155] When the spatial dividing level is loaded, the control unit 510 spatially divides the overall handwritten signature block by the spatial dividing level (n) which is set previously according to a desired handwritten signature authentication precision (S317).. In case where only the vertical dividing is performed, the control unit 510 divides the overall handwritten signature block (1) by the spatial dividing level (n) to generate 22 segment blocks as shown in FIGS. 3 and 6 (S317). In case where only the horizontal dividing is performed, the control unit 510 divides the overall handwritten signature block (1) by the spatial dividing level (n) to generate 22 segment blocks as shown in FIG. 4 (S317).

    [0156] After the generation of the segment blocks, the control unit 510 generates the segment dynamic behavioral characteristics information (ψi) and the overall segment dynamic behavioral characteristics information (Ψ), and detects the segment block position information (pi) (S319).

    [0157] After the detection of the segment block position information (pi), the control unit 510 detects the segment block space information (space(si)) by calculating the space area of each segment block based on the segment block position information (pi) (S321).

    [0158] After the generation of the segment block space information (space(si)), the control unit 510 detects the segment image of each segment block from the stored accumulative touch data (S323).

    [0159] After the detection of the segment image, the control unit 510 analyzes the detected segment image to check whether there exist any sub-segment image, and detects the sub-segment image if there exists the sub-segment image (S325).

    [0160] When the sub-segment image is detected, the control unit 510 generates the the sub-segment block (śi.x) including the sub-segment image (S327).

    [0161] Also, when the sub-segment image is detected, the control unit 510 detects the sub-segment block position information (ṕi.x) which is the position information of the the sub-segment block (śi.x) (S329).

    [0162] After the generation of the sub-segment block position information (ṕi.x), the control unit 510 detects the sub-segment block space information (space(śi.x)) (S331).

    [0163] When the sub-segment block space information is generated, the control unit 510 counts and stores the number (m) of the sub-segment blocks and the number (I) of the adjacent sub-segment blocks (S331). For example, the number of the adjacent sub-segment block of the first sub-segment block (2-1-1) in the first segment block (2-1) is one (i.e. adjacent sub-segment block 2-1-2), and the number of the adjacent sub-segment blocks of the second sub-segment block (2-1-2) is two (i.e. adjacent sub-segment blocks 2-1-1 and 2-1-3).

    [0164] Now, the method of generating the dynamic movement point information (αi) and the method of generating the segment dynamic behavioral characteristics information (ψi) from the dynamic movement point information (αi) and the overall segment dynamic behavioral characteristics information (Ψ) will be described in detail.

    [0165] The dynamic movement tracking unit 690 generates the dynamic movement point information (αi) describing each point constituting the handwritten signature as shown in FIGS. 3 and 4.

    [0166] The dynamic movement point information (αi) (hereinafter, referred to as "point" for the convenience of explanation) may be composed as shown in Equation 12.



    [0167] Here, 'αi.prev' denotes a point indicating a point (α(i-1)), 'αi.id' denotes a point identification number (i.e. 'i'), corresponding to the point (αi), 'αi.x' denotes x-coordinate of the point (αi), 'αi.y' denotes y-coordinate of the point (αi), 'αi.ts' denotes a timestamp value of the point (αi), 'αi.sid' denotes a spatial-division segment ID of the segment to which the point (αi) belongs, 'αi.gid' denotes a group ID of a group, disjointed from the segment block, to which the point (αi) belongs, and 'αi. next' denotes a point indicating a point (α(i+1)). Therefore, 'αi.sid' represents the segment the point (αi) belongs among the spatially-divided segments, and 'αi.gid' represents the group the point (αi) belongs among the groups generated by disjointing one or more segments.

    [0168] Though the dynamic movement point information (αi) expressed by the Equation 12 contains point elements including information of the previous dynamic movement point, x- and y-coordinates of the dynamic movement point, the timestamp value, the spatial-division segment ID, the group ID of dynamic movement point, and the next dynamic movement point, the dynamic movement point information may be composed to contain at least one of the elements or to contain additional information.

    [0169] The overall handwritten signature block (S) is a set of the segment blocks (si) divided spatially and may be composed as shown in Equation 13.



    [0170] Also, a set of points included in the segment block (si) may be composed as shown in Equation 14.



    [0171] Thus, a set (AP) of all the points comprising the handwritten signature may be composed as shown in Equation 15.



    [0172] A function for determining whether any two points (aj,ak,j ≠ k) belong to a same segment block (si) is defined by Equation 16.



    [0173] That is, in case that two points (aj,ak,j ≠ k) belong to the same segment block (si), the segment ID's of the two points (aj,ak) are the same as each other (i.e. αj.sid = ak.sid). On the other hand, in case that two points (aj,ak,j ≠ k) belong to different segment blocks, the segment ID's of the two points (aj,ak) are different from each other (i.e. αj.sid ≠ ak.sid).

    [0174] A function for determining whether any two points (aj,ak,j ≠ k) belong to a same group that may be disjointed from the segment block is defined by Equation 17.



    [0175] That is, in case that two points (aj,ak,j ≠ k) belong to the same group, the group ID's of the two points (aj,ak) are the same as each other (i.e. αj.gid = ak.gid), which indicates that the points are not disjointed into separate groups. On the other hand, in case that two points (aj,ak,j ≠ k) belong to different groups, the group ID's of the two points (aj,ak) are different from each other (i.e. αj.gid ≠ ak.gid), which indicates that the points are disjointed into separate groups.

    [0176] A function for determining connection characteristics, that is, whether any two points (aj,ak,j ≠ k) are connected in a same segment block (si) is defined by Equation 18, and a set of all the possible connection characteristics is defined by Equation Equation 19.





    [0177] Here, 'length(j,k)' means a distance between the two points (aj,ak).

    [0178] Marginal termination points at each edge of the segment (si) is calculated by Equation 20, internal termination points in the segment (si) is calculated by Equation 21, and all the termination points in the segment (si) is calculated by Equation 22.







    [0179] Therefore, all the termination points (Seg_DOT1) for the segment block (2-2) shown in FIG. 3 may be calculated as follows:

    ▪ Left_DOT1 = {left10, left11, left12, left13} where Lcnt1 = 4

    ▪ Right_DOT1 = {right10, right11,right12} where Rent1 = 3

    ▪ Top_DOT1 = {0̸} where Tcnt1 = 0

    ▪ Bottom_DOT1 = {0̸} where Bcnt1 = 0

    ▪ In_DOT1 = {in10} where incnt1 = 1

    ▪ Seg_DOT1 = {left10,left11, left12,left13, right10, right11, right12, in10}

    where total1 = 8

    [0180] For all the termination points (Seg_DOT1) of the segment block (2-2) shown in FIG. 3 which are calculated according to the equations, two termination points (left10, left11) are connected to each other and there is a link between the points, two termination points (left13,left12) are connected to each other and there is a link between the points, two termination points (in10, right10) are connected to each other and there is a link between the points, and two termination points (right12, right11) are connected to each other and there is a link between the points. Thus, the connection characteristics among all the termination points (LINK1) is calculated as follows:

    where LINKcnt1 = 4

    [0181] Also, all the termination points (Seg_DOT1) for the segment block (2-3) shown in FIG. 3 may be calculated as follows:

    ▪ Left_DOT2 = {left20, left21, left22, left23} where Lcnt2 = 4

    ▪ Right_DOT2 = {right20, right21, right22} where Rcnt2 = 3

    ▪ Top_DOT2 = {0̸} where Tcnt2 = 0

    ▪ Bottom_DOT2 = {0̸} where Bcnt2 = 0

    ▪ In_DOT2 = {in20} where incnt2 = 1

    ▪ Seg_DOT2 = {left20, left21, left22, left23, right20, right21, right22, in20}

    where total2 = 8

    [0182] For all the termination points (Seg_DOT2) of the segment block (2-3) shown in FIG. 3 which are calculated as above, two termination points (left20,left22) are connected to each other and there is a link between the points, two termination points (left21, right20) are connected to each other and there is a link between the points, two termination points (right21, in20) are connected to each other and there is a link between the points, and two termination points (left23, right22) are connected to each other and there is a link between the points. Thus, the connection characteristics among all the termination points (LINK2) is calculated as follows:

    where LINKcnt2 = 4

    [0183] Also, all the termination points (Seg_DOT3) for the segment block (2-3) shown in FIG. 4 may be calculated as follows:

    ▪ Left_DOT3 = {0̸} where Lcnt2 = 0

    ▪ Right_DOT3 = {0̸} where Rcnt2 = 0

    ▪ Top_DOT3 = {top20, top21, top22, top23, top24} where Tcnt2 = 5

    ▪ Bottom_DOT3 = {bottom20, bottom21, bottom22, bottom23, bottom24, bottom25}

    where Bcnt2 = 6
    ▪ In_DOT3 = {in20} where incnt2 = 1

    where total2 = 12

    [0184] For all the termination points (Seg_DOT3) of the segment block (2-3) shown in FIG. 4 which are calculated as above, two termination points (top20,bottom20) are connected to each other and there is a link between the points, two termination points (top22,top21) are connected to each other and there is a link between the points, two termination points (top23, in20) are connected to each other and there is a link between the points, two termination points (bottom21, bottom22) are connected to each other and there is a link between the points, two termination points (top24,bottom25) are connected to each other and there is a link between the points, and two termination points (bottom24,bottom24) are connected to each other and there is a link between the points. Thus, the connection characteristics among all the termination points (LINK3) is calculated as follows:

    where LINKcnt2 = 6

    [0185] Also, all the termination points (Seg_DOT4) for the segment block (2-5) shown in FIG. 5 may be calculated as follows:

    ▪ LeftDOT4 = {0̸} where Lcnt4 = 0

    ▪ RightDOT4 = {0̸} where Rcnt4 = 0

    ▪ TopDOT2 = {top40, top41} where Tcnt4 = 2

    ▪ BottomDOT2 = {bottom40} where Bcnt4 = 1

    ▪ In_DOT2 = {in40, in41, in42} where incnt4 = 3

    ▪ Seg_DOT4 = {top40, top41, bottom40, in40, in41, in42} where total4 = 6



    [0186] For all the termination points (Seg_DOT4) of the segment block (2-5) shown in FIG. 5 which are calculated as above, two termination points (top40, in40) are connected to each other and there is a link between the points, two termination points (top41, in41) are connected to each other and there is a link between the points, and two termination points (in42, bottom40) are connected to each other and there is a link between the points. Thus, the connection characteristics among all the termination points (LINK4) is calculated as follows:

    where LINKcnt4 = 3

    [0187] Therefore, all the termination points (All_Seg_DOT) and all the connection characteristics (All_LINK) are composed according to Equations 23 and 24, respectively.





    [0188] A partial ordered set (oseti) of the points at all the termination points (Seg_DOTi) in the segment block (si) is composed according to Equation 25.



    [0189] Here, 'order(αj)' denotes an arrangement order of arbitrary points (αj) in the set. A sequence (order(αj) < orderk)) between two points two points (aj,ak) means an arrangement order that the point (αj) is later than the point (αk).

    [0190] The partial ordered set (oset1) in the segment block (2-2) shown in FIG. 3 may be expressed as follows:



    [0191] Also, the partial ordered set (oset2) in the segment block (2-3) shown in FIG. 3 may be expressed as follows:



    [0192] Also, the partial ordered set (oset3) in the segment block (2-3) shown in FIG. 4 may be expressed as follows:



    [0193] Also, the partial ordered set (oset4) in the segment block (2-5) shown in FIG. 5 may be expressed as follows:



    [0194] Therefore, the partial ordered set (OSET) for the overall handwritten signature is composed according to Equation 26.



    [0195] Based on the information calculated as above, the segment dynamic behavioral characteristics information (ψi) and the overall segment dynamic behavioral characteristics information (Ψ) are generated according to Equations 27 and 28, respectively.





    [0196] Also, the segment transition dynamic behavioral characteristics information (ti) for the dynamic behaviors taken during a segment transition while the handwritten signature is carried out and the overall segment transition dynamic behavioral characteristics information (T) is generated according to Equations 29 and 30, respectively.



    [0197] Here, 'tmax' denotes a maximum number of occurrences of the segment transition dynamic movement. Also, 'ti' indicates that the transition occurs from an outgoing point which is one of marginal termination points in the segment (sj) to an incoming point which is one of marginal termination points in the segment (sk) during the transition dynamic movement. Thus, 't0' denotes the segment transition dynamic behavioral characteristics information of a first segment transition, and 'ttmax-1' denotes the segment transition dynamic behavioral characteristics information of a last segment transition.

    [0198] For example, the segment transition dynamic behavioral characteristics information ('t0) of a first segment transition in the segment block (2-1) in FIG. 3 means that the segment transition occurs from a right marginal termination point (right00) of the segment (s0) which is the outgoing point to a left marginal termination point (left10) of the segment (s1) which is the incoming point, and is generated as follows:



    [0199] Further, the segment transition dynamic behavioral characteristics information ('t1) of a second segment transition in the segment block (2-2) in FIG. 3 means that the segment transition occurs from a left marginal termination point (left11) of the segment (s1) which is the outgoing point to a right marginal termination point (right01) of the segment (s0) which is the incoming point, and is generated as follows:



    [0200] If the operation continues as above, the segment transition dynamic behavioral characteristics information ('ttmax-1) of a last segment transition can be generated.



    [0201] It should be understood that exemplary embodiments described herein should be considered in a descriptive sense only and not for purposes of limitation. Descriptions of features or aspects within each exemplary embodiment should typically be considered as available for other similar features or aspects in other exemplary embodiments. While one or more exemplary embodiments have been described with reference to the figures, it will be understood by those of ordinary skill in the art that various changes in form and details may be made therein without departing from the scope as defined by the following claims.

    [Description of Reference Numerals]



    [0202] 

    1: Overall Handwritten Signature Block, 2: Segment Block

    100: Enrollment Unit, 200: Input Unit

    300: Output Unit, 400: Handwritten Signature Input Unit

    410:

    500: Handwritten Signature Authentication Unit, 510: Control Unit

    520: Handwritten Signature Characteristics Extraction Unit, 530: Handwritten Signature Tracking Unit

    540: Handwritten Signature Image Acquisition Unit, 550: Handwritten Signature Characteristics Acquisition Unit

    560: Handwritten Signature Segment Block Authentication Unit

    610: Handwritten Signature Start Detection Unit

    620: Handwritten Signature End Detection Unit

    630: Spatial-Division Segment Detection Unit

    640: Segment Count Unit

    650: Spatial-Division Segment Block Characteristics Detection Unit

    651: Sub-segment Block Generation Unit

    652: Segment Block Position Detection Unit

    653: Segment Block Space Characteristics Detection Unit

    654: Space Ratio Characteristics Detection Unit

    655: Segment Block Characteristics Information Generation Unit

    660: Overall Handwritten Signature Block Characteristics Detection Unit

    670: Sub-segment Block Correlation Detection Unit

    671: Intersection Space Detection Unit

    672: Intersection Space Ratio Detection Unit

    673: Sub-segment Block Inclusion Relation Detection Unit

    674: Sub-segment Block Positional Relation Detection Unit

    675: Sub-segment Block Edge Positional Relation Detection Unit

    677: Correlation Characteristics Information Generation Unit

    680: Handwritten Signature Characteristics information Generation Unit

    690: Dynamic Movement Tracking Unit




    Claims

    1. A system for authenticating a handwritten signature based on dynamic movement tracking of spatial-division segment, the system comprising:

    a handwritten signature input unit (400) that includes a touch input unit (420) configured to output touch data, as handwritten signature input data, including position data and pressure data for positions that are touched by a signer for handwritten signature;

    an enrollment unit (100) configured to enroll overall handwritten signature block characteristics information (Σ) of each signer; and

    a handwritten signature authentication unit (500) configured to store the handwritten signature input data including the touch data received from the handwritten signature input unit (400), generate a handwritten signature image by identifying the handwritten signature by use of the handwritten signature input data, generate a spatial overall handwritten signature block (S, S313) defined by a top, a bottom, a leftmost and a rightmost points of the overall handwritten signature and including the handwritten signature, generate segment blocks by spatially dividing generated overall handwritten signature block (S) by a predetermined number of divisions (S317), detect a segment image for each of the generated segment blocks (S323), collect the handwritten signature characteristics information (Σ) including the overall handwritten signature block (S) information, each segment block information, correlation information between the overall handwritten signature block (S) and each segment block (S119), map the collected handwritten signature characteristics information to identification information of the signer, enroll the collected handwritten signature characteristics information in the enrollment unit (100, S121), collect handwritten signature characteristics information (Σ) including the overall handwritten signature block (S) information, each segment block information, correlation information between the overall handwritten signature block (S) and each segment block from the touch data entered through the touch input unit (420) of the handwritten signature input unit (400) (S127) upon receiving a request for handwritten signature authentication (S113), load the enrolled handwritten signature characteristics information (Σ') that corresponds with the identification information of the signer (S129) who requests the handwritten signature authentication, and perform the handwritten signature authentication based on segments of the handwritten signature according to a match rate (S133) by comparing the enrolled handwritten signature characteristics information (Σ', S131) with the collected handwritten signature characteristics information (Σ).


     
    2. The system of claim 1, wherein the handwritten signature authentication unit (500) comprises:

    a handwritten signature characteristics extraction unit (520) configured to store the handwritten signature input data received through the touch input unit (420) of the handwritten signature input unit (400), generate the handwritten signature image by identifying the handwritten signature by use of the handwritten signature input data, generate the overall handwritten signature block (S) including the handwritten signature (S313), generate the segment blocks by spatially dividing the generated overall handwritten signature block (S) by the predetermined number of divisions (S317), detect the segment image of each of the generated segment blocks (S323), and extract the handwritten signature characteristics information (Σ) including overall handwritten signature block characteristics information (Q) of the overall handwritten signature block (S), overall segment block characteristics information (V) of the segment blocks constituting the handwritten signature, overall segment block position information (P) of the segment blocks including sub-segment block position information, and overall segment block correlation characteristics information (C) including the correlation information between the overall handwritten signature block (S) and each segment block (S249);

    a handwritten signature segment block authentication unit (560) configured to perform a handwritten signature authentication according to a predetermined match rate (S133) by comparing the handwritten signature characteristics information (Σ, S131) extracted by the handwritten signature characteristics extraction unit (520) with the pre-enrolled handwritten signature characteristics information (Σ'); and

    a control unit (510) configured to save and enroll the handwritten signature characteristics information (S121) extracted by the handwritten signature characteristics extraction unit (520) to the enrollment unit (100) upon receiving a request for enrollment, and perform a handwritten signature authentication by controlling the handwritten signature segment block authentication unit (560) upon receiving the request for handwritten signature authentication.


     
    3. The system of claim 2, wherein the handwritten signature characteristics extraction unit (520) comprises:

    a handwritten signature start detection unit (610) configured to detect a start of the handwritten signature from the touch data;

    a handwritten signature end detection unit (620) configured to detect an end of the handwritten signature by designating a final touch data input point as an end point of the handwritten signature when there is no touch data input for a certain period of time after the touch data is entered;

    a spatial-division segment detection unit (630) configured to generate the handwritten signature image by identifying the handwritten signature by use of the handwritten signature input data received through the touch input unit (420), generate the overall handwritten signature block (S) including the handwritten signature (S313), generate the segment blocks by spatially dividing the generated overall handwritten signature block (S) by the predetermined number of divisions (S317), and detect the segment image for each of the generated segment blocks (S323);

    a segment count unit (640) configured to count a number of sub-segments detected by the spatial-division segment detection unit (630) (S222);

    a spatial-division segment block characteristics detection unit (650) configured to receive the segment image, determine whether the segment image is divided, generate a sub-segment block (śi.x, S327) including the sub-segment when a sub-segment image re-segmented from the segment image is detected, generate segment block characteristics information (vi, S225) and sub-segment block characteristics information (v́i, S235, S237, S239) for the segment block (si) and the sub-segment block (śi.x), respectively, and generate (S249) and output the overall segment block characteristics information (V) including the segment block characteristics information (vi) and the sub-segment block characteristics information (v́i) along with the overall segment block position information (P);

    an overall handwritten signature block characteristics detection unit (660) configured to generate (S249) and output the overall handwritten signature block characteristics information (Q) of the overall handwritten signature block (S);

    a sub-segment block correlation detection unit (670) configured to generate (S249) and output the overall segment block correlation characteristics information (C) including correlation information between at least two of the overall handwritten signature block (S), the segment block, and the sub-segment blocks; and

    a handwritten signature characteristics acquisition unit (550) including a handwritten signature characteristics information generation unit (680) configured to generate (S119, S127) and output the handwritten signature characteristics information (Σ) including the overall handwritten signature block characteristics information (Q), the overall segment block characteristics information (V), the overall segment block position information (P), and the overall segment block correlation characteristics information (C).


     
    4. The system of claim 3, wherein the overall handwritten signature block characteristics detection unit (660) further generates and outputs overall handwritten signature block space information (space(S)) by calculating space area of the overall handwritten signature block (S) (S217),
    wherein the spatial-division segment block characteristics detection unit (650) comprises:

    a sub-segment block generation unit (651) configured to receive the segment image as input, determine whether the segment image is divided, and generate the sub-segment block (śi.x) including the sub-segment when the sub-segment image re-segmented from the segment image is detected (S327);

    a segment block position detection unit (652) configured to receive the segment block (si) and the sub-segment block (śi.x), and detect and output segment block position information (pi) the sub-segment block position information (ṕi.x) which represent edges of the segment block and the sub-segment blocks (S329), respectively;

    a segment block space characteristics detection unit (653) configured to receive at least one of the segment block (si), the sub-segment block (śi.x), the segment block position information (pi), and the sub-segment block position information (ṕi.x) and generate and output segment block space information (space(si)) and sub-segment block space information (space(śi.x)) by calculating space areas of the segment block (si) and the sub-segment block (śi.x) (S331);

    a space ratio characteristics detection unit (654) configured to receive the overall handwritten signature block space information (space(S)), the segment block space information (space(si)), and sub-segment block space information (space(śi.x)) from the overall handwritten signature block characteristics detection unit (660), calculate a ratio of a segment block space to an overall handwritten signature block space, a ratio of a sub-segment block space to the overall handwritten signature block space, and a ratio of the sub-segment block space to the segment block space, and generate and output at least one of ratio information (Δi) of the segment block space to the overall handwritten signature block space, ratio information (Δ́i.x) of the sub-segment block space to the overall handwritten signature block space, and ratio information (έi.x) of the sub-segment block space to the segment block space (S223); and

    a segment block characteristics information generation unit (655) configured to generate the segment block characteristics information (vi) and the sub-segment block characteristics information (v́i) including corresponding information selected from: the segment block position information (pi) of each segment of the handwritten signature, the sub-segment block position information (ṕi.x), the segment block space information (space(si)), the sub-segment block space information (space(śi.x)), the ratio information (Δi) of the segment block space to the overall handwritten signature block space, the ratio information (Δ́i.x) of the sub-segment block space to the overall handwritten signature block space, and the ratio information (έi.x) of the sub-segment block space to the segment block space, and generate and output the overall segment block characteristics information (V) for all segment blocks of the handwritten signature (S119, S127).


     
    5. The system of claim 4, wherein the block is a polygon,
    wherein the sub-segment block generation unit (651) generates a polygon sub-segment block surrounding the segment by passing through a top, a bottom, a leftmost, and a rightmost points of the sub-segment.
     
    6. The system of claim 4, wherein the sub-segment block correlation detection unit (670) comprises:

    an intersection space detection unit (671) configured to detect any adjacent sub-segment block (śi.y) having a relation of inclusion or intersection with the sub-segment block (śi.x), and output, if any, intersection space information (δ́i.xy) by calculating space of inclusion or intersection area (S229);

    an intersection space ratio detection unit (672) configured to receive the overall handwritten signature block space information (space(S)), the segment block space information (space(si)), sub-segment block space information (space(śi.x)), and sub-segment block intersection space information (δ́i.xy), generate the ratio information (ŕi.xy) of the sub-segment block intersection space to the overall handwritten signature block space by calculating a ratio of the sub-segment block intersection space (δ́i.xy) to the overall handwritten signature block space (space(S)), generate ratio information (π́i(δ́ij)) of the sub-segment block intersection space to the sub-segment block space by calculating a ratio of the sub-segment block intersection space (δ́i.xy) to the sub-segment block space (space(śi.x)), and generate ratio information (π́j(δ́ij)) of the sub-segment block intersection space to an adjacent sub-segment block space by calculating a ratio of the sub-segment block intersection space (δ́i.xy) to the adjacent sub-segment block space (space(śi.y)) (S223, S231, S232);

    a segment block inclusion relation detection unit (673) configured to generate and output sub-segment block inclusion relation information (ói.xy) which shows whether the adjacent sub-segment block (śi.y) is included in or intersects the sub-segment block (śi.x) (S235);

    a segment positional relation detection unit configured to generate and output sub-segment block positional relation information (pósi.xy) representing relative position of the adjacent sub-segment block (śi.y) with respect to the sub-segment block (śi.x) (S237);

    an edge positional relation detection unit (675) configured to generate and output sub-segment block edge positional relation information (ed́gei.xy) representing relative edge position at which edge of the sub-segment block (śi.x) intersects the adjacent sub-segment block (śi.y) (S239); and

    a correlation characteristics information generation unit (677) configured to generate and output overall segment block correlation characteristics information (C) including the sub-segment block intersection space information (δ́i,xy), the ratio information (ŕi.xy) of the sub-segment block intersection space to the overall handwritten signature block space the ratio information (π́i(δ́ij)) of the sub-segment block intersection space to the sub-segment block space, the ratio information (π́j(δ́ij)) of the sub-segment block intersection space to the adjacent sub-segment block space, the sub-segment block inclusion relation information (ói.xy), the sub-segment block positional relation information (pósi.xy), and the sub-segment block edge positional relation information (ed́gei.xy) (S249).


     
    7. The system of claim 3, wherein the handwritten signature characteristics extraction unit (520) comprises:

    a dynamic movement tracking unit (690) configured to generate overall segment dynamic behavioral characteristics information (Ψ) by calculating segment dynamic behavioral characteristics information (ψi) representing dynamic behavioral characteristics occurred through dynamic movement of the handwritten signature based on received dynamic movement point information (αi) in the spatially-divided segment block and generate overall segment transition dynamic behavioral characteristics information (T) by calculating segment transition dynamic behavioral characteristics information (ti) (S318),

    wherein the spatial-division segment detection unit (630) generates the dynamic movement point information αi), whenever the touch data is input, for a position at which the touch data occurs and outputs the dynamic movement point information (αi) to the dynamic movement tracking unit (690),

    wherein the handwritten signature characteristics acquisition unit (550) generates and outputs the handwritten signature characteristics information (Σ) further including the overall segment dynamic behavioral characteristics information (Ψ) and the overall segment transition dynamic behavioral characteristics information (T) in addition to the overall handwritten signature block characteristics information (Q), the overall segment block characteristics information (V), the overall segment block position information (P), and the overall segment block correlation characteristics information (C) (S119, S127).


     
    8. The system of claim 7, wherein the dynamic movement point information (αi) is composed according to a following equation 31.


     
    9. The system of claim 1, wherein the segment dynamic behavioral characteristics information (ψi) representing dynamic behavioral characteristics is composed according to Equation 32,
    wherein the overall segment dynamic behavioral characteristics information (Ψ) is composed according to Equation 33.




     
    10. The system of claim 1, wherein a segment transition dynamic behavioral characteristics information (ti) between the spatial-division segments is composed according to Equation 34,
    wherein an overall segment transition dynamic behavioral characteristics information (T) is composed according to Equation 35.




     
    11. A method of authenticating a handwritten signature based on dynamic movement tracking of spatial-division segment, the method comprising:

    an enrollment process of enrolling overall handwritten signature block characteristics information of each signer; storing handwritten signature input data including touch data received from a handwritten signature input unit (400), the touch data including position data and pressure data for positions that are touched by a signer for handwritten signature;

    generating a handwritten signature image by identifying the handwritten signature by use of the handwritten signature input data, generating a spatial overall handwritten signature block (S) (S313) defined by a top, a bottom, a leftmost and a rightmost points of the overall handwritten signature and including the handwritten signature, generating segment blocks by spatially dividing generated overall handwritten signature block (S) by a predetermined number of divisions (S317), detecting a segment image for each of the generated segment blocks (S323), collecting handwritten signature characteristics information (Σ) including the overall handwritten signature block (S) information, each segment block information, correlation information between the overall handwritten signature block (S) and each segment block (S119), mapping the collected handwritten signature characteristics information to identification information of the signer, and enrolling the collected handwritten signature characteristics information in an enrollment unit (100, S121); and

    a handwritten signature authentication process of collecting handwritten signature characteristics information (Σ) including the overall handwritten signature block (S) information, each segment block information, correlation information between the overall handwritten signature block (S) and each segment block from the touch data entered through a touch input unit (420) of a handwritten signature input unit (400) (S127) upon a request for handwritten signature authentication (S113), loading enrolled handwritten signature characteristics information (Σ') that corresponds with the identification information of the signer who requests the handwritten signature authentication (S129), and performing the handwritten signature authentication based on segments of the handwritten signature according to a match rate (S133) by comparing the enrolled handwritten signature characteristics information (Σ') with the collected handwritten signature characteristics information (Σ, S131).


     
    12. The method of claim 11, wherein the enrollment process comprises:

    an enrollment request monitoring operation that monitors whether a request for handwritten signature enrollment is made (S111);

    a signer identification information acquisition operation that acquires the signer identification information to be enrolled upon request for handwritten signature enrollment (S115);

    a handwritten signature characteristics information acquisition operation that acquires the handwritten signature characteristics information (Σ) from touch data entered through the touch input unit (420) regarding to the handwritten signature of the signer (S119); and

    a handwritten signature enrollment operation that maps the handwritten signature characteristics information to the identification information of the signer and enrolls the handwritten signature characteristics information in the enrollment unit (100, S121).


     
    13. The method of claim 11, wherein the handwritten signature authentication process comprises:

    a handwritten signature authentication request monitoring operation that monitors whether the request for handwritten signature authentication is made (S113);

    a signer identification information acquisition operation that acquires the signer identification information upon receiving the request for handwritten signature authentication (S125);

    a handwritten signature characteristics information acquiring operation that acquires the handwritten signature characteristics information (Σ) from the touch data received through the touch input unit for the handwritten signature of the signer (S127);

    an enrolled handwritten signature characteristics information loading operation that loads the pre-enrolled handwritten signature characteristics information (Σ') corresponding with the acquired signer identification information (S129); and

    a handwritten signature authentication operation that performs handwritten signature authentication by comparing the acquired handwritten signature characteristics information (Σ) with the enrolled handwritten signature characteristics information (Σ') as loaded and outputs a result of the authentication (S131).


     
    14. The method of claim 12 or 13, wherein the handwritten signature characteristics information (Σ) acquisition operation comprises:

    a handwritten signature tracking operation that begins tracking of the handwritten signature from the touch data of the handwritten signature input data entered through the handwritten signature input unit (400);

    a segment detection operation that generates the handwritten signature image by identifying the handwritten signature by use of the handwritten signature input data received through the touch input unit (420), generates the overall handwritten signature block (S) including the handwritten signature (S313), generates the segment blocks by spatially dividing the overall handwritten signature block (S) by the predetermined number of divisions (S317), and detects and outputs the segment image for each of the segment blocks (S323);

    a segment count operation that counts a number of the sub-segments detected in the spatial-division segment detection operation (S222);

    a segment block characteristics detecting operation that receives the segment image, determines whether the segment image is divided, generates a sub-segment block (śi.x, S327) including the sub-segment when a sub-segment image re-segmented from the segment image is detected, generates segment block characteristics information (v¡, S225) and sub-segment block characteristics information (v́¡, S235, S237, S239) for the segment block (si) and the sub-segment block (śi.x), respectively, and generate (S249) and output overall segment block characteristics information (V) including the segment block characteristics information (vi) and the sub-segment block characteristics information (v́i);

    an overall handwritten signature block characteristics detection operation that generates (S249) and outputs overall handwritten signature block characteristics information (Q) of the overall handwritten signature block (S);

    a segment block correlation detection operation that generates and outputs the overall segment block correlation characteristics information (C) including correlation information between at least two of the overall handwritten signature block (S), the segment block, and the sub-segment blocks (S249); and

    a handwritten signature characteristics information generation operation that generates the overall segment block characteristics information (V) including the segment block characteristics information (vi) and the sub-segment block characteristics information (v́i) for all the segments and sub-segments, respectively, and generates and outputs the handwritten signature characteristics information (Σ) including the overall handwritten signature block characteristics information (Q), the overall segment block characteristics information (V) (S249), overall segment block position information (P) of the generated segment blocks (S319) including sub-segment block position information, overall segment block correlation characteristics information (C), and overall segment dynamic behavioral characteristics information (Ψ) (S318).


     
    15. The method of claim 14, wherein the overall handwritten signature block characteristics detection operation further generates and outputs overall handwritten signature block space information (space(S)) by calculating space area of the overall handwritten signature block (S) (S217),
    wherein the segment block characteristics detection operation comprises:

    a sub-segment block generation operation that receives the segment image as input, determines whether the segment image is divided, and generates and outputs the sub-segment block (śi.x) including the sub-segment when the sub-segment image re-segmented from the segment image is detected (S327);

    a segment block position detection operation that receives the segment block (si) and the sub-segment block (śi.x), and detects and outputs segment block position information (pi) the sub-segment block position information (ṕi.x) which represent edges of the segment block and the sub-segment blocks, respectively (S329);

    a segment block space characteristics detection operation that receives at least one of the segment block (s¡), the sub-segment block (śi.x), the segment block position information (pi), and the sub-segment block position information (ṕi.x) and generates and outputs segment block space information (space(si)) and sub-segment block space information (space(śi.x)) by calculating space areas of the segment block (si) and the sub-segment block (śi.x) (S331);

    a space ratio characteristics detection operation that receives the overall handwritten signature block space information (space(S)), the segment block space information (space(si)), and sub-segment block space information (space(śi.x)), calculates a ratio of a segment block space to an overall handwritten signature block space, a ratio of a sub-segment block space to the overall handwritten signature block space, and a ratio of the sub-segment block space to the segment block space, and generates and outputs at least one of ratio information (Δi) of the segment block space to the overall handwritten signature block space, ratio information (Δ́i.x) of the sub-segment block space to the overall handwritten signature block space, and ratio information (έi.x) of the sub-segment block space to the segment block space (S223); and

    a segment block characteristics information generation operation that generates the segment block characteristics information (vi) and the sub-segment block characteristics information (v́i) including corresponding information selected from: the segment block position information (pi) of each segment of the handwritten signature, the sub-segment block position information (ṕi.x), the segment block space information (space(si)), the sub-segment block space information (space(śi.x)), the ratio information (Δi) of the segment block space to the overall handwritten signature block space, the ratio information (Δ́i.x) of the sub-segment block space to the overall handwritten signature block space, and the ratio information (έi.x) of the sub-segment block space to the segment block space, and generates and outputs the overall segment block characteristics information (V) for all segment blocks of the handwritten signature (S119, S127).


     
    16. The method of claim 15, wherein the segment block correlation detection operation comprises:

    an intersection space detection operation that detects any adjacent sub-segment block (śi.y) having a relation of inclusion or intersection with the sub-segment block (śi.x), and outputs, if any, intersection space information (δ́i.xy) by calculating space of inclusion or intersection area (S229);

    an intersection space ratio detection operation that receives the overall handwritten signature block space information (space(S)), the segment block space information (space(si)), sub-segment block space information (space(śi.x)), and sub-segment block intersection space information (δ́i.xy), generates the ratio information (ŕi.xy) of the sub-segment block intersection space to the overall handwritten signature block space by calculating a ratio of the sub-segment block intersection space (δ́i.xy) to the overall handwritten signature block space (space(S)), generates ratio information (π́i(δ́ij)) of the sub-segment block intersection space to the sub-segment block space by calculating a ratio of the sub-segment block intersection space (δ́i.xy) to the sub-segment block space (space(śi.x)), and generates ratio information (π́j(δ́ij)) of the sub-segment block intersection space to an adjacent sub-segment block space by calculating a ratio of the sub-segment block intersection space (δ́i.xy) to the adjacent sub-segment block space (space(śi.y)) (S223, S231, S232);

    a segment block inclusion relation detection operation that generates and outputs sub-segment block inclusion relation information (ói.xy) which shows whether the adjacent sub-segment block (śi.y) is included in or intersects the sub-segment block (śi.x) (S237);

    a segment positional relation detection operation that generates and outputs sub-segment block positional relation information (pósi.xy) representing relative position of the adjacent sub-segment block (śi.y) with respect to the sub-segment block (śi.x) (S239);

    an edge positional relation detection operation that generates and outputs sub-segment block edge positional relation information (ed́gei.xy) representing relative edge position at which edge of the sub-segment block (śi.x) intersects the adjacent sub-segment block (śi.y) (S239); and

    a correlation characteristics information generation operation that generates and outputs overall segment block correlation characteristics information (C) including the sub-segment block intersection space information (δ́i.xy), the ratio information (ŕi.xy) of the sub-segment block intersection space to the overall handwritten signature block space the ratio information (π́i(δ́ij)) of the sub-segment block intersection space to the sub-segment block space, the ratio information ((π́j (δ́ij)) of the sub-segment block intersection space to the adjacent sub-segment block space, the sub-segment block inclusion relation information (ói.xy), the sub-segment block positional relation information (pósi.xy), and the sub-segment block edge positional relation information (ed́gei.xy) (S249).


     
    17. The method of claim 14, wherein the handwritten signature characteristics information acquisition operation comprises:

    a dynamic movement tracking operation that generates overall segment dynamic behavioral characteristics information (Ψ) by calculating segment dynamic behavioral characteristics information (ψi) representing dynamic behavioral characteristics occurred through dynamic movement of the handwritten signature based on received dynamic movement point information (αi) in the spatially-divided segment block and generates overall segment transition dynamic behavioral characteristics information (T) by calculating segment transition dynamic behavioral characteristics information (ti) (S318),

    wherein, in the spatial-division segment detection operation, dynamic movement point information (αi) is generated whenever the touch data is input for a position at which the touch data occurs and is output for the dynamic movement tracking operation,

    wherein the handwritten signature characteristics generation operation generates and outputs the handwritten signature characteristics information (Σ) further including the overall segment dynamic behavioral characteristics information (Ψ) and the overall segment transition dynamic behavioral characteristics information (T) in addition to the overall handwritten signature block characteristics information (Q), the overall segment block characteristics information (V), the overall segment block position information (P), and the overall segment block correlation characteristics information (C) (S119, S127).


     
    18. The method of claim 17, wherein the dynamic movement point information (αi) is composed according to a following equation 36.


     
    19. The method of claim 16, wherein the segment dynamic behavioral characteristics information (ψi) representing dynamic behavioral characteristics is composed according to Equation 37,
    wherein the overall segment dynamic behavioral characteristics information (Ψ) is composed according to Equation 38..




     
    20. The method of claim 16, wherein a segment transition dynamic behavioral characteristics information (ti) between the spatial-division segments is composed according to Equation 39,
    wherein an overall segment transition dynamic behavioral characteristics information (T) is composed according to Equation 40.




     


    Ansprüche

    1. Ein System zum Authentifizieren einer handschriftlichen Unterschrift basierend auf Dynamikbewegungsverfolgung eines räumlichen Unterteilungssegments, wobei das System folgendes aufweist:

    eine handschriftliche Unterschriftseingabeeinheit (400), die eine Berührungseingabeeinheit (420) aufweist, die konfiguriert ist, um Berührungsdaten als handschriftliche Unterschriftseingabedaten auszugeben, einschließlich Positionsdaten und Druckdaten für Positionen, die durch einen Unterzeichner für eine handschriftliche Unterschrift berührt werden;

    eine Registrierungseinheit (100), die konfiguriert ist, um eine gesamte handschriftliche Unterschriftsblockeigenschaftsinformation (Σ) von jedem Unterzeichner zu registrieren; und

    eine handschriftliche Unterschriftenauthentifizierungseinheit (500), die konfiguriert ist zum: Speichern der handschriftlichen Unterschriftseingabedaten, einschließlich der Berührungsdaten, die von der handschriftlichen Unterschriftseingabeeinheit (400) empfangenen wurden, Erzeugen eines handschriftlichen Unterschriftsbilds durch Identifizieren der handschriftlichen Unterschrift durch Verwendung der handschriftlichen Unterschriftseingabedaten, Erzeugen eines räumlich gesamten handschriftlichen Unterschriftsblocks (S, S313), der durch einen oberen, einen unteren, einen ganz linken und einen ganz rechten Punkt der gesamten handschriftlichen Unterschrift und einschließlich der handschriftlichen Unterschrift definiert ist, Erzeugen von Segmentblöcken durch räumliches Unterteilen eines erzeugten gesamten handschriftlichen Unterschriftsblocks (S) durch eine vorbestimmte Anzahl von Unterteilungen (S317), Detektieren eines Segmentbilds für jeden der erzeugten Segmentblöcke (S323), Sammeln der handschriftlichen Unterschriftseigenschaftsinformation (Σ), einschließlich der gesamten handschriftlichen Unterschriftsblocks (S) -information, jeder Segmentblockinformation, Korrelationsinformation zwischen dem gesamten handschriftlichen Unterschriftsblock (S) und jedem Segmentblock (S119), Abbilden der gesammelten handschriftlichen Unterschriftseigenschaftsinformation auf Identifikationsinformation des Unterzeichners, Registrieren der gesammelten handschriftlichen Unterschriftseigenschaftsinformation in der Registrierungseinheit (100, S121), Sammeln von handschriftlicher Unterschriftseigenschaftsinformation (Σ), einschließlich der gesamten handschriftlichen Unterschriftsblock (S) -information, jeder Segmentblockinformation, Korrelationsinformation zwischen dem gesamten handschriftlichen Unterschriftsblock (S) und jedem Segmentblock von den Berührungsdaten, die durch die Berührungseingabeeinheit (420) der handschriftliche Unterschriftseingabeeinheit (400) eingegeben wurden (S127), und zwar auf Empfang einer Aufforderung zur handschriftlichen Unterschriftsauthentifizierung hin (S113), Laden der registrierten handschriftlichen Unterschriftseigenschaftsinformation (Σ'), die der Identifizierungsinformation des Unterzeichners entspricht (S129), der die handschriftliche Unterschriftsauthentifizierung beantragt, und Durchführen der handschriftlichen Unterschriftauthentifizierung basierend auf Segmenten der handschriftlichen Unterschrift gemäß einer Übereinstimmungsrate (S133) durch Vergleichen der registrierten handschriftlichen Unterschriftseigenschaftsinformation (Σ', S131) mit der gesammelten handschriftlichen Unterschriftseigenschaftsinformation (Σ).


     
    2. Das System nach Anspruch 1, wobei die handschriftliche Unterschriftsauthentifizierungseinheit (500) folgendes aufweist:

    eine handschriftliche Unterschriftseigenschaftsextraktionseinheit (520), die konfiguriert ist zum: Speichern der handschriftlichen Unterschriftseingabedaten, die durch die Berührungseingabeeinheit (420) der handschriftlichen Unterschriftseingabeeinheit (400) empfangen wurden, Erzeugen des handschriftlichen Unterschriftsbilds durch Identifizieren der handschriftlichen Unterschrift durch Verwendung der handschriftlichen Unterschriftseingabedaten, Erzeugen des gesamten handschriftlichen Unterschriftsblocks (S), einschließlich der handschriftlichen Unterschrift (S313), Erzeugen der Segmentblöcke durch räumliches Unterteilen des erzeugten gesamten handschriftlichen Unterschriftblocks (S) durch die vorbestimmte Anzahl von Unterteilungen (S317), Detektieren des Segmentbilds von jedem der erzeugten Segmentblöcke (S323), und Extrahieren der handschriftlichen Unterschriftseigenschaftsinformation (Σ), einschließlich einer gesamten handschriftlichen Unterschriftsblockeigenschaftsinformation (Q) des gesamten handschriftlichen Unterschriftsblocks (S), einer gesamten Segmentblockeigenschaftsinformation (V) der Segmentblöcke, welche die handschriftliche Unterschrift bilden, einer gesamten Segmentblockpositionsinformation (P) der Segmentblöcke, einschließlich einer Teilsegmentblockpositionsinformation, und einer gesamten Segmentblockkorrelationseigenschaftsinformation (C), einschließlich der Korrelationsinformation zwischen dem gesamten handschriftlichen Unterschriftsblock (S) und jedem Segmentblock (S249);

    eine handschriftliche Unterschriftssegmentblockauthentifizierungseinheit (560), die konfiguriert ist zum: Durchführen einer handschriftlichen Unterschriftsauthentifizierung gemäß einer vorbestimmten Übereinstimmungsrate (S133) durch Vergleichen der handschriftlichen Unterschriftseigenschaftsinformation (Σ, S131), die durch die handschriftliche Unterschriftseigenschaftsextraktionseinheit (520) extrahiert wurde, mit der vorregistrierten handschriftlichen Unterschriftseigenschaftsinformation (Σ'); und

    eine Steuereinheit (510), die konfiguriert ist zum: Speichern und Registrieren der handschriftlichen Unterschriftseigenschaftsinformation (S121), die durch die handschriftliche Unterschriftseigenschaftsextraktionseinheit (520) extrahiert wurde, in der Registrierungseinheit (100), und zwar auf Empfang einer Aufforderung zur Registrierung hin, und Durchführen einer handschriftlichen Unterschriftsauthentifizierung, und zwar durch Steuern der handschriftlichen Unterschriftssegmentblockauthentifizierungseinheit (560) auf den Empfang der Aufforderung zur handschriftlichen Unterschriftsauthentifizierung hin.


     
    3. Das System nach Anspruch 2, wobei die handschriftliche Unterschriftseigenschaftsextraktionseinheit (520) folgendes aufweist:

    eine handschriftliche Unterschriftsstartdetektionseinheit (610), die konfiguriert ist, um einen Start der handschriftlichen Unterschrift von den Berührungsdaten zu detektieren;

    eine handschriftliche Unterschriftsenddetektionseinheit (620), die konfiguriert ist, um ein Ende von der handschriftlichen Unterschrift zu detektieren, und zwar durch Bestimmen eines letzten Berührungsdateneingabepunkts als einen Endpunkt der handschriftlichen Unterschrift, wenn es keine Berührungsdateneingabe für einen bestimmten Zeitraum gibt, nachdem die Berührungsdaten eingegeben wurden;

    eine räumliche Unterteilungssegmentdetektionseinheit (630), die konfiguriert ist zum: Erzeugen des handschriftlichen Unterschriftsbilds durch Identifizieren der handschriftlichen Unterschrift durch Verwendung der handschriftlichen Unterschriftseingabedaten, die durch die Berührungseingabeeinheit (420) empfangen wurden, Erzeugen des gesamten handschriftlichen Unterschriftsblock (S), einschließlich der handschriftlichen Unterschrift (S313), Erzeugen der Segmentblöcke durch räumliches Unterteilen des erzeugten gesamten handschriftlichen Unterschriftsblocks (S) durch die vorbestimmte Anzahl von Unterteilungen (S317), und Detektieren des Segmentbilds für jeden der erzeugten Segmentblöcke (S323);

    eine Segmentzähleinheit (640), die konfiguriert ist, um eine Anzahl von Teilsegmenten zu zählen, die durch die räumliche Unterteilungssegmentdetektionseinheit (630) detektiert wurden (S222);

    eine räumliche Unterteilungssegmentblockeigenschaftsdetektionseinheit (650), die konfiguriert ist zum: Empfangen des Segmentbilds, Bestimmen, ob das Segmentbild unterteilt ist, Erzeugen eines Teilsegmentblocks (śi.x, S327), einschließlich des Teilsegments, wenn ein von dem Segmentbild neu segmentiertes Teilsegmentbild detektiert wird, Erzeugen von Segmentblockeigenschaftsinformation (vi, S225) und eine Teilsegmentblockeigenschaftsinformation (v́i, S235, S237, S239) für den Segmentblock (si) bzw. den Teilsegmentblock (śi.x), und Erzeugen (S249) und Ausgeben der gesamten Segmentblockeigenschaftsinformation (V), einschließlich der Segmentblockeigenschaftsinformation (vi) und der Teilsegmentblockeigenschaftsinformation (v́i) zusammen mit der gesamten Segmentblockpositionsinformation (P);

    eine gesamte handschriftliche Unterschriftsblockeigenschaftsdetektionseinheit (660), die konfiguriert ist, um die gesamte handschriftliche Unterschriftsblockeigenschaftsinformation (Q) des gesamten handschriftlichen Unterschriftsblocks (S) zu erzeugen (S249) und auszugeben;

    eine Teilsegmentblockkorrelationsdetektionseinheit (670), die konfiguriert ist, um die gesamte Segmentblockkorrelationseigenschaftsinformation (C) einschließlich von Korrelationsinformation zwischen wenigstens zwei von dem gesamten handschriftlichen Unterschriftsblock (S), dem Segmentblock und den Teilsegmentblöcken zu erzeugen (S249) und auszugeben; und

    eine handschriftliche Unterschriftseigenschaftserfassungseinheit (550), einschließlich einer handschriftlichen Unterschriftseigenschaftsinformationserzeugungseinheit (680), die konfiguriert ist, um die handschriftliche Unterschriftseigenschaftsinformation (Σ), einschließlich der gesamten handschriftlichen Unterschriftsblockeigenschaftsinformation (Q), der gesamten Segmentblockeigenschaftsinformation (V), der gesamten Segmentblockpositionsinformation (P) und der gesamten Segmentblockkorrelationseigenschaftsinformation (C) zu erzeugen (S119, S127) und auszugeben.


     
    4. Das System nach Anspruch 3, wobei die gesamte handschriftliche Unterschriftsblockeigenschaftsdetektionseinheit (660) ferner eine gesamte handschriftliche Unterschriftsblockrauminformation (raum(S)) durch Berechnen eines Raumbereichs des gesamten handschriftlichen Unterschriftsblocks (S) erzeugt und ausgibt (S217),
    wobei die räumliche Unterteilungssegmentblockeigenschaftsdetektionseinheit (650) folgendes aufweist:

    eine Teilsegmentblockerzeugungseinheit (651), die konfiguriert ist zum: Empfangen des Segmentbilds als Eingabe, Bestimmen, ob das Segmentbild unterteilt ist, und Erzeugen des Teilsegmentblocks (śi.x), einschließlich des Teilsegments, wenn das von dem Segmentbild neu segmentierte Teilsegmentbild detektiert wird (S327);

    eine Segmentblockpositionsdetektionseinheit (652), die konfiguriert ist, um den Segmentblock (si) und den Teilsegmentblock (śi.x) zu empfangen, und um eine Segmentblockpositionsinformation (pi) die Teilsegmentblockpositionsinformation (ṕi.x), welche Ränder des Segmentblocks bzw. des Teilsegmentblocks darstellen, zu detektieren und auszugeben (S329);

    eine Segmentblockraumeigenschaftsdetektionseinheit (653) die konfiguriert ist, um wenigstens eines von dem Segmentblock (si), dem Teilsegmentblock (śi.x), der Segmentblockpositionsinformation (pi) und der Teilsegmentblockpositionsinformation (ṕi.x) zu empfangen, und um eine Segmentblockrauminformation (raum(si)) und Teilsegmentblockrauminformation (raum(śi.x)) durch Berechnen von Raumbereichen des Segmentblocks (s¡) und des Teilsegmentblocks (śi.x) zu erzeugen und auszugeben (S331);

    eine Raumverhältniseigenschaftsdetektionseinheit (654), die konfiguriert ist zum: Empfangen der gesamten handschriftlichen Unterschriftsblockrauminformation (raum(S)), der Segmentblockrauminformation (raum(si)), und von Teilsegmentblockrauminformation (raum(śi.x)) von der gesamten handschriftlichen Unterschriftsblockeigenschaftsdetektionseinheit (660), Berechnen eines Verhältnisses von einem Segmentblockraum zu einem gesamten handschriftlichen Unterschriftsblockraum, eines Verhältnisses von einem Teilsegmentblockraum zu dem gesamten handschriftlichen Unterschriftsblockraums, und eines Verhältnisses von dem Teilsegmentblockraum zu dem Segmentblockraum, und Erzeugen und Ausgeben von wenigstens eines von einer Verhältnisinformation (Δi) des Segmentblockraums zu dem gesamten handschriftlichen Unterschriftsblockraum, einer Verhältnisinformation (Δ́i.x) des Teilsegmentblockraums zu dem gesamten handschriftlichen Unterschriftsblockraum, und einer Verhältnisinformation (έi.x) des Teilsegmentblockraums zu dem Segmentblockraum (S223); und

    eine Segmentblockeigenschaftsinformationserzeugungseinheit (655), die konfiguriert ist, um die Segmentblockeigenschaftsinfonnation (vi) und die Teilsegmentblockeigenschaftsinformation (v́i) zu erzeugen, und zwar einschließlich von entsprechender Information, welche von folgenden ausgewählt ist: die Segmentblockpositionsinformation (pi) von jedem Segment der handschriftlichen Unterschrift, die Teilsegmentblockpositionsinformation (ṕi.x), die Segmentblockrauminformation (raum(si)), die Teilsegmentblockrauminformation (raum(śi.x)), die Verhältnisinformation (Δi) des Segmentblockraums zu dem gesamten handschriftlichen Unterschriftsblockraum, die Verhältnisinformation (Δ́i.x) des Teilsegmentblockraums zu dem gesamten handschriftlichen Unterschriftsblockraum, und die Verhältnisinformation (έi.x) des Teilsegmentblockraums zu dem Segmentblockraum, und um die gesamte Segmentblockeigenschaftsinformation (V) für alle Segmentblöcke der handschriftlichen Unterschrift zu erzeugen und auszugeben (S119, S127).


     
    5. Das System nach Anspruch 4, wobei der Block ein Polygon ist,
    wobei die Teilsegmentblockerzeugungseinheit (651) einen Polygonteilsegmentblock erzeugt, der das Segment umgibt, und zwar durch Durchgehen durch einen oberen, einen unteren, einen ganz linken und einen ganz rechten Punkt des Teilsegments.
     
    6. Das System nach Anspruch 4, wobei die Teilsegmentblockkorrelationsdetektionseinheit (670) folgendes aufweist:

    eine Schnittraumdetektionseinheit (671), welche konfiguriert ist, um einen anliegenden Teilsegmentblock (śi.y) mit einer Einschluss- oder Schnittbeziehung mit dem Teilsegmentblock (śi.x) zu detektieren und, falls vorhanden, eine Schnittrauminformation (δ́i.xy) durch Berechnen eines Einschlussraums oder Schnittbereichs auszugeben (S229);

    eine Schnittraumverhältnisdetektionseinheit (672), welche konfiguriert ist zum: Empfangen der gesamtes handschriftliches Unterschriftsblockrauminformation (raum(S)), der Segmentblockrauminformation (raum(si)), Teilsegmentblockrauminformation (raum(śi.x)), und Teilsegmentblockschnittrauminformation (δ́i.xy), Erzeugen der Verhältnisinformation (ŕi.xy) des Teilsegmentblockschnittraums zu dem gesamten handschriftlichen Unterschriftsblockraums, und zwar durch Berechnen eines Verhältnisses des Teilsegmentblockschnittraums (δ́i.xy) zu dem gesamten handschriftlichen Unterschriftsblockraum (raum(S)), Erzeugen einer Verhältnisinformation (π́i(δ́ij)) des Teilsegmentblockschnittraums zu dem Teilsegmentblockraums, und zwar durch Berechnen eines Verhältnisses des Teilsegmentblockschnittraums (δ́i.xy) zu dem Teilsegmentblockraum (raum(śi.x)), und Erzeugen einer Verhältnisinformation (π́j(δ́ij)) des Teilsegmentblockschnittraums zu einem anliegenden Teilsegmentblockraum, und zwar durch Berechnen eines Verhältnisses des Teilsegmentblockschnittraums (δ́i.xy) zu dem anliegenden Teilsegmentblockraum (raum(śi.y)) (S223, S231, S232);

    eine Segmentblockeinschlussbeziehungsdetektionseinheit (673), die konfiguriert ist, eine Teilsegmentblockeinschlussbeziehungsinformation (ói.xy), welche zeigt, ob der anliegende Teilsegmentblock (śi.y) in dem Teilsegmentblock (śi.x) enthalten ist oder diesen schneidet, zu erzeugen und auszugeben (S235);

    eine Segmentpositionsbeziehungsdetektionseinheit, welche konfiguriert ist, um eine Teilsegmentblockpositionsbeziehungsinformation (pósi.xy), welche eine relative Position des anliegenden Teilsegmentblocks (śi.y) in Bezug zu dem Teilsegmentblock (śi.x) darstellt, zu erzeugen und auszugeben (S237);

    eine Randpositionsbeziehungsdetektionseinheit (675), welche konfiguriert ist, um eine Teilsegmentblockrandpositionsbeziehungsinformation (rańdi.xy), welche eine relative Randposition darstellt, an welchem Rand des Teilsegmentblocks (śi.x) den anliegenden Teilsegmentblock (śi.y) schneidet, zu erzeugen und auszugeben (S239); und

    eine Korrelationseigenschaftsinformationserzeugungseinheit (677), die konfiguriert ist, um die gesamte Segmentblockkorrelationseigenschaftsinformation (C), einschließlich der Teilsegmentblockschnittrauminformation (δ́i.xy), der Verhältnisinformation (ŕi.xy) des Teilsegmentblockschnittraums zu dem gesamten handschriftlichen Unterschriftsblockraums, der Verhältnisinformation (π́i(δ́ij)) des Teilsegmentblockschnittraums zu dem Teilsegmentblockraum, der Verhältnisinformation (π́j(δ́ij)) des Teilsegmentblockschnittraums zu dem anliegenden Teilsegmentblockraum, der Teilsegmentblockeinschlussbeziehungsinformation (ói.xy), der Teilsegmentblockpositionsbeziehungsinformation (pósi.xy), und der Teilsegmentblockrandpositionsbeziehungsinformation (rańdi.xy) zu erzeugen und auszugeben (S249).


     
    7. Das System nach Anspruch 3, wobei die handschriftliche Unterschriftseigenschaftsextraktionseinheit (520) folgendes aufweist:

    eine Dynamikbewegungsverfolgungseinheit (690), die konfiguriert ist, um eine gesamte Segmentdynamikverhaltenseigenschaftsinformation (Ψ) zu erzeugen, und zwar durch Berechnen einer Segmentdynamikverhaltenseigenschaftsinformation (ψi,), welche eine Dynamikverhaltenseigenschaft darstellt, die durch eine dynamische Bewegung der handschriftlichen Unterschrift basierend auf einer empfangenen Dynamikbewegungspunktinformation (αi) in dem räumlich unterteilten Segmentblock auftritt, und um die gesamte Segmentübergangsdynamikverhaltenseigenschaftsinformation (T) durch Berechnen einer Segmentübergangsdynamikverhaltenseigenschaftsinformation (ti) zu erzeugen (S318),

    wobei die räumliche Unterteilungssegmentdetektionseinheit (630) die Dynamikbewegungspunktinformation (αi) erzeugt, und zwar, wann immer die Berührungsdaten eingegeben werden, für eine Position, an welcher die Berührungsdaten auftreten, und die Dynamikbewegungspunktinformation (αi) an die Dynamikbewegungsverfolgungseinheit (690) ausgibt,

    wobei die handschriftliche Unterschriftseigenschaftserfassungseinheit (550) die handschriftliche Unterschriftseigenschaftsinformation (Σ), welche ferner die gesamte Segmentdynamikverhaltenseigenschaftsinformation (Ψ) und die gesamte Segmentübergangsdynamikverhaltenseigenschaftsinformation (T), zusätzlich zu der gesamten handschriftlichen Unterschriftsblockeigenschaftsinformation (Q), der gesamten Segmentblockeigenschaftsinformation (V), der gesamten Segmentblockpositionsinformation (P), und der gesamten Segmentblockkorrelationseigenschaftsinformation (C) aufweist, erzeugt und ausgibt (S119, S127).


     
    8. Das System nach Anspruch 7, wobei die Dynamikbewegungspunktinformation (αi) gemäß einer folgenden Gleichung 31 zusammengesetzt ist.


     
    9. Das System nach Anspruch 1, wobei die Segmentdynamikverhaltenseigenschaftsinformation (ψi), welche die Dynamikverhaltenseigenschaft darstellt, gemäß Gleichung 32 zusammengesetzt ist,
    wobei die gesamte Segmentdynamikverhaltenseigenschaftsinformation (Ψ) gemäß Gleichung 33 zusammengesetzt ist.




     
    10. Das System nach Anspruch 1, wobei eine Segmentübergangsdynamikverhaltenseigenschaftsinformation (ti) zwischen den räumlich unterteilten Segmenten gemäß Gleichung 34 zusammengesetzt ist,
    wobei eine gesamte Segmentübergangsdynamikverhaltenseigenschaftsinformation (T) gemäß Gleichung 35 zusammengesetzt ist.




     
    11. Ein Verfahren des Authentifizierens einer handschriftlichen Unterschrift basierend auf Dynamikbewegungsverfolgung eines räumlichen Unterteilungssegments, wobei das Verfahren folgendes aufweist:

    einen Registrierungsprozess des Registrierens einer gesamten handschriftlichen Unterschriftsblockeigenschaftsinformation von jedem Unterzeichner;

    Speichern von handschriftlichen Unterschriftseingabedaten, die Berührungsdaten, die von einer handschriftlichen Unterschriftseingabeeinheit (400) empfangenen wurden, aufweisen, wobei die Berührungsdaten Positionsdaten und Druckdaten für Positionen, die von einem Unterzeichner für handschriftliche Unterschrift berührt werden, aufweisen;

    Erzeugen eines handschriftlichen Unterschriftsbilds durch Identifizieren der handschriftlichen Unterschrift durch Verwendung der handschriftlichen Unterschriftseingabedaten, Erzeugen eines räumlich gesamten handschriftlichen Unterschriftsblocks (S) (S313), der durch einen oberen, einen unteren, einen ganz linken und einen ganz rechten Punkt der gesamten handschriftlichen Unterschrift und einschließlich der handschriftlichen Unterschrift definiert ist, Erzeugen von Segmentblöcken durch räumliches Unterteilen eines erzeugten gesamten handschriftlichen Unterschriftsblocks (S) durch eine vorbestimmte Anzahl von Unterteilungen (S317), Detektieren eines Segmentbilds für jeden der erzeugten Segmentblöcke (S323), Sammeln von handschriftlichen Unterschriftseigenschaftsinformation (Σ), einschließlich der gesamten handschriftlichen Unterschriftsblocks (S) -information, jeder Segmentblockinformation, Korrelationsinformation zwischen dem gesamten handschriftlichen Unterschriftsblock (S) und jedem Segmentblock (S119), Abbilden der gesammelten handschriftlichen Unterschriftseigenschaftsinformation auf Identifikationsinformation des Unterzeichners, und Registrieren der gesammelten handschriftlichen Unterschriftseigenschaftsinformation in einer Registrierungseinheit (100, S121); und

    einen handschriftlichen Unterschriftsauthentifizierungsprozess des Sammelns einer handschriftlichen Unterschriftseigenschaftsinformation (Σ), einschließlich der gesamten handschriftlichen Unterschriftsblock (S) -information, jeder Segmentblockinformation, Korrelationsinformation zwischen dem gesamten handschriftlichen Unterschriftsblock (S) und jedem Segmentblock von den Berührungsdaten, die durch eine Berührungseingabeeinheit (420) einer handschriftlichen Unterschriftseingabeeinheit (400) eingegeben wurden (S127), und zwar auf eine Aufforderung zur handschriftlichen Unterschriftsauthentifizierung hin (S113), Laden registrierter handschriftlicher Unterschriftseigenschaftsinformation (Σ'), die der Identifizierungsinformation des Unterzeichners entspricht, der die handschriftliche Unterschriftsauthentifizierung angefordert hat (S129), und Durchführen der handschriftlichen Unterschriftauthentifizierung basierend auf Segmenten der handschriftlichen Unterschrift gemäß einer Übereinstimmungsrate (S133) durch Vergleichen der registrierten handschriftlichen Unterschriftseigenschaftsinformation (Σ') mit der gesammelten handschriftlichen Unterschriftseigenschaftsinformation (Σ, S131).


     
    12. Das Verfahren nach Anspruch 11, wobei der Registrierungsprozess folgendes aufweist:

    einen Registrierungsaufforderungsüberwachungsbetrieb, welcher überwacht, ob eine Aufforderung für eine handschriftliche Unterschriftsregistrierung gemacht wird (S111);

    einen Unterzeichneridentifikationsinformationserfassungsbetrieb, welcher die zu registrierende Unterzeichneridentifikationsinformation auf eine Aufforderung für eine handschriftliche Unterschriftsregistrierung hin erfasst (S115);

    einen handschriftlichen Unterschriftseigenschaftsinformationserfassungsbetrieb, welcher die handschriftliche Unterschriftseigenschaftsinformation (Σ) von Berührungsdaten, welche durch die Berührungseingabeeinheit (420) in Bezug auf die handschriftliche Unterschrift des Unterzeichners eingegeben wurden (S119), erfasst; und

    einen handschriftlichen Unterschriftsregistrierungsbetrieb, welcher die handschriftliche Unterschriftseigenschaftsinformation auf eine Identifikationsinformation des Unterzeichners abbildet und die handschriftliche Unterschriftseigenschaftsinformation registriert, und zwar in der Registrierungseinheit (100, S121).


     
    13. Das Verfahren nach Anspruch 11, wobei der handschriftliche Unterschriftsauthentifizierungsprozess folgendes aufweist:

    einen handschriftlichen Unterschriftsauthentifizierungsaufforderungsüberwachungsbetrieb, welcher überwacht, ob die Aufforderung zur handschriftlichen Unterschriftsauthentifizierung gemacht wird (S113);

    einen Unterzeichneridentifikationsinformationserfassungsbetrieb, welcher die Unterzeichneridentifikationsinformation auf den Empfang der Aufforderung zur handschriftlichen Unterschriftsauthentifizierung hin erfasst (S125);

    einen handschriftlichen Unterschriftseigenschaftsinformationserfassungsbetrieb, welcher die handschriftliche Unterschriftseigenschaftsinformation (Σ) von den Berührungsdaten, die durch die Berührungseingabeeinheit für die handschriftliche Unterschrift des Unterzeichners empfangen wurden, erfasst (S127);

    einen registrierten handschriftlichen Unterschriftseigenschaftsinformationsladebetrieb, welcher die vorregistrierte handschriftliche Unterschriftseigenschaftsinformation (Σ'), welche der erfassten Unterzeichneridentifikationsinformation entspricht, lädt (S129); und

    einen handschriftlichen Unterschriftsauthentifizierungsbetrieb, welcher die handschriftliche Unterschriftsauthentifizierung durchführt, und zwar durch Vergleichen der erfassten handschriftliche Unterschriftseigenschaftsinformation (Σ) mit der registrierten handschriftlichen Unterschriftseigenschaftsinformation (Σ') wie geladen, und ein Ergebnis der Authentifizierung ausgibt (S131).


     
    14. Das Verfahren nach Anspruch 12 oder 13, wobei der handschriftliche Unterschriftseigenschaftsinformation (Σ) -erfassungsbetrieb folgendes aufweist:

    einen handschriftlichen Unterschriftsverfolgungsbetrieb, welcher eine Verfolgung der handschriftlichen Unterschrift von den Berührungsdaten der handschriftlichen Unterschriftseingabedaten, welche durch die handschriftliche Unterschriftseingabeeinheit (400) eingegeben wurden, beginnt;

    einen Segmentdetektionsbetrieb, der das handschriftliche Unterschriftsbild durch Identifizierung der handschriftlichen Unterschrift durch Verwendung von den handschriftlichen Unterschriftseingabedaten, welche durch Berührungseingabeeinheit (420) empfangen wurden, erzeugt, den gesamten handschriftlichen Unterschriftsblock (S), einschließlich der handschriftlichen Unterschrift, erzeugt (S313), die Segmentblöcke durch räumliches Unterteilen des gesamten handschriftlichen Unterschriftsblocks (S) durch die vorbestimmte Anzahl von Unterteilungen erzeugt (S317), und das Segmentbild für jeden der Segmentblöcke detektiert und ausgibt (S323);

    einen Segmentzählbetrieb, der eine Anzahl der Teilsegmente zählt, welche in dem räumlich unterteilten Segmentdetektionsbetrieb detektiert wurden (S222);

    einen Segmentblockeigenschaftsdetektionsbetrieb, welcher das Segmentbild empfängt, bestimmt, ob das Segmentbild unterteilt ist, einen Teilsegmentblock (śi.x, S327) erzeugt, und zwar einschließlich das Teilsegments, wenn ein vom dem Segmentbild neu segmentiertes Teilsegmentbild detektiert wird, eine Segmentblockeigenschaftsinformation (vi, S225) und eine Teilsegmentblockeigenschaftsinformation (v́i, S235, S237, S239) für den Segmentblock (si) bzw. den Teilsegmentblock (śi.x) erzeugt, und die gesamte Segmentblockeigenschaftsinformation (V), einschließlich der Segmentblockeigenschaftsinformation (vi) und der Teilsegmentblockeigenschaftsinformation (v́i) erzeugt (S249) und ausgibt;

    einen gesamten handschriftlichen Unterschriftsblockeigenschaftsdetektionsbetrieb der eine gesamte handschriftliche Unterschriftsblockeigenschaftsinformation (Q) des gesamten handschriftlichen Unterschriftsblocks (S) erzeugt (S249) und ausgibt;

    einen Segmentblockkorrelationsdetektionsbetrieb, der die gesamte Segmentblockkorrelationseigenschaftsinformation (C), einschließlich Korrelationsinformation zwischen wenigstens zwei von dem gesamten handschriftlichen Unterschriftsblock (S), dem Segmentblock, und den Teilsegmentblöcken, erzeugt und ausgibt (S249); und

    einen handschriftlichen Unterschriftseigenschaftsinformationserzeugungsbetrieb, der die gesamte Segmentblockeigenschaftsinformation (V), einschließlich der Segmentblockeigenschaftsinformation (vi) und der Teilsegmentblockeigenschaftsinformation (v́i) für alle Segmente bzw. Teilsegmente, erzeugt, und die handschriftliche Unterschriftseigenschaftsinformation (Σ), einschließlich der gesamten handschriftlichen Unterschriftsblockeigenschaftsinformation (Q), der gesamten Segmentblockeigenschaftsinformation (V) (S249), einer gesamten Segmentblockpositionsinformation (P) der erzeugten Segmentblöcke (S319), einschließlich einer Teilsegmentblockpositionsinformation, einer gesamten Segmentblockkorrelationseigenschaftsinformation (C), und einer gesamten Segmentdynamikverhaltenseigenschaftsinformation (Ψ), erzeugt und ausgibt (S318).


     
    15. Das Verfahren nach Anspruch 14, wobei der gesamte handschriftliche Unterschriftsblockeigenschaftsdetektionsbetrieb ferner eine gesamte handschriftliche Unterschriftsblockrauminformation (raum(S)) erzeugt und ausgibt, und zwar durch Berechnen eines Raumbereichs des gesamten handschriftlichen Unterschriftsblocks (S) (S217),
    wobei der Segmentblockeigenschaftsdetektionsbetrieb folgendes aufweist:

    einen Teilsegmentblockerzeugungsbetrieb, welcher das Segmentbild als Eingabe empfängt, bestimmt, ob das Segmentbild unterteilt ist, und den Teilsegmentblock (śi.x) einschließlich des Teilsegments erzeugt und ausgibt, wenn das von dem Segmentbild neu segmentierte Teilsegmentbild detektiert wird (S327);

    einen Segmentblockpositionsdetektionsbetrieb, welcher den Segmentblock (si) und den Teilsegmentblock (śi.x) empfängt, und Segmentblockpositionsinformation (pi) die Teilsegmentblockpositionsinformation (ṕi.x), welche Ränder des Segmentblocks bzw. des Teilsegmentblocks darstellen, detektiert und ausgibt (S329);

    einen Segmentblockraumeigenschaftsdetektionsbetrieb, welcher wenigstens einen von dem Segmentblock (si), dem Teilsegmentblock (si.x), der Segmentblockpositionsinformation (pi), und der Teilsegmentblockpositionsinformation (ṕi.x) empfängt, und Segmentblockrauminformation (raum(si)) und Teilsegmentblockrauminformation (raum(śi.x)) erzeugt und ausgibt, und zwar durch Berechnen von Raumbereichen des Segmentblocks (si) und des Teilsegmentblocks (śi.x) (S331);

    einen Raumverhältniseigenschaftsdetektionsbetrieb, welcher die gesamte handschriftliche Unterschriftsblockrauminformation (raum(S) ), die Segmentblockrauminformation (raum(si)), und Teilsegmentblockrauminformation (raum(śi.x)) empfängt, ein Verhältnis von einem Segmentblockraums zu einem gesamten handschriftlichen Unterschriftsblockraum, ein Verhältnis von einem Teilsegmentblockraum zu dem gesamten handschriftlichen Unterschriftsblockraum, und ein Verhältnis von dem Teilsegmentblockraum zu dem Segmentblockraum berechnet, und wenigstens eines von Verhältnisinformation (Δi) von dem Segmentblockraum zu dem gesamten handschriftlichen Unterschriftsblockraum, Verhältnisinformation (Δ́i.x) von dem Teilsegmentblockraum zu dem gesamten handschriftlichen Unterschriftsblockraum, und Verhältnisinformation (έi.x) von dem Teilsegmentblockraum zu dem Segmentblockraum erzeugt und ausgibt (S223); und

    einen Segmentblockeigenschaftsinformationserzeugungsbetrieb, welcher die Segmentblockeigenschaftsinformation (vi) und die Teilsegmentblockeigenschaftsinformation (v́i) erzeugt, einschließlich der entsprechenden Information, welche von folgendem ausgewählt werden: die Segmentblockpositionsinformation (pi) von jedem Segment der handschriftlichen Unterschrift, die Teilsegmentblockpositionsinformation (ṕi.x), die Segmentblockrauminformation (raum(si)), die Teilsegmentblockrauminformation (raum(śi.x)), die Verhältnisinformation (Δi) des Segmentblockraums zu dem gesamten handschriftlichen Unterschriftsblockraum, die Verhältnisinformation (Δ́i.x) des Teilsegmentblockraums zu dem gesamten handschriftlichen Unterschriftsblockraum, und die Verhältnisinformation (έi.x) des Teilsegmentblockraums zu dem Segmentblockraum, und die gesamte Segmentblockeigenschaftsinformation (V) für alle Segmentblöcke der handschriftlichen Unterschrift erzeugt und ausgibt (S119, S127).


     
    16. Das Verfahren nach Anspruch 15, wobei der Segmentblockkorrelationsdetektionsbetrieb folgendes aufweist:

    einen Schnittraumdetektionsbetrieb, welcher einen anliegenden Teilsegmentblock (śi.y) mit einer Einschluss- oder Schnittbeziehung mit dem Teilsegmentblock (śi.x) detektiert und, falls vorhanden, eine Schnittrauminformation (δ́i.xy) durch Berechnen eines Einschlussraums oder Schnittbereichs ausgibt (S229);

    einen Schnittraumverhältnisdetektionsbetrieb, welcher die gesamte handschriftliche Unterschriftsblockrauminformation (raum(S)), die Segmentblockrauminformation (raum(si)), Teilsegmentblockrauminformation (raum(śi.x)), und Teilsegmentblockschnittrauminformation (δ́i.xy) empfängt, die Verhältnisinformation (ŕi.xy) des Teilsegmentblockschnittraums zu dem gesamten handschriftlichen Unterschriftsblockraums erzeugt, und zwar durch Berechnen eines Verhältnisses des Teilsegmentblockschnittraums (δ́i.xy) zu dem gesamten handschriftlichen Unterschriftsblockraum (raum(S)), eine Verhältnisinformation (π́i(δ́ij)) des Teilsegmentblockschnittraums zu dem Teilsegmentblockraum erzeugt, und zwar durch Berechnen eines Verhältnisses des Teilsegmentblockschnittraums (δ́i.xy) zu dem Teilsegmentblockraum (raum(śi.x)), und eine Verhältnisinformation (π́j(δ́ij)) des Teilsegmentblockschnittraums zu einen anliegenden Teilsegmentblockraums erzeugt, und zwar durch Berechnen eines Verhältnisses des Teilsegmentblockschnittraums (δ́i.xy) zu dem anliegenden Teilsegmentblockraum (raum(śi.y)) (S223, S231, S232);

    einen Segmentblockeinschlussbeziehungsdetektionsbetrieb, welcher Teilsegmentblockeinschlussbeziehungsinformation (ói.xy), welche zeigt, ob der anliegende Teilsegmentblock (śi.y) in dem Teilsegmentblock (śi.x) enthalten ist oder diesen schneidet, erzeugt und ausgibt (S237);

    einen Segmentpositionsbeziehungsdetektionsbetrieb, welcher eine Teilsegmentblockpositionsbeziehungsinformation (pósi.xy), welche eine relative Position des anliegenden Teilsegmentblocks (śi.y) in Bezug zu dem Teilsegmentblock (śi.x) darstellt, erzeugt und ausgibt (S239);

    einen Randpositionsbeziehungsdetektionsbetrieb, welcher eine Teilsegmentblockrandpositionsbeziehungsinformation (rańdi.xy), welche eine relative Randposition, an welchem Rand des Teilsegmentblock (śi.x) den anliegenden Teilsegmentblock (śi.y) schneidet, repräsentiert, erzeugt und ausgibt (S239); und

    einen Korrelationseigenschaftsinformationserzeugungsbetrieb, welcher die gesamte Segmentblockkorrelationseigenschaftsinformation (C), einschließlich der Teilsegmentblockschnittrauminformation (δ́i.xy), der Verhältnisinformation (ŕi.xy) von dem Teilsegmentblockschnittraum zu dem gesamten handschriftlichen Unterschriftsblockraum, der Verhältnisinformation (π́i(δ́ij)) von dem Teilsegmentblockschnittraum zu dem Teilsegmentblockraum, der Verhältnisinformation (π́j(δ́ij)) von dem Teilsegmentblockschnittraum zu dem anliegenden Teilsegmentblockraum, der Teilsegmentblockeinschlussbeziehungsinformation (ói.xy), der Teilsegmentblockpositionsbeziehungsinformation (pósi.xy), und der Teilsegmentblockrandpositionsbeziehungsinformation (randi.xy) erzeugt und ausgibt (S249).


     
    17. Das Verfahren nach Anspruch 14, wobei der handschriftliche Unterschriftseigenschaftsinformationserfassungsbetrieb folgendes aufweist:

    einen Dynamikbewegungsverfolgungsbetrieb, der eine gesamte Segmentdynamikverhaltenseigenschaftsinformation (Ψ) erzeugt, und zwar durch Berechnen einer Segmentdynamikverhaltenseigenschaftsinformation (ψi), welche eine Dynamikverhaltenseigenschaft darstellt, die durch eine dynamische Bewegung der handschriftlichen Unterschrift basierend auf einer empfangenen Dynamikbewegungspunktinformation (αi) in dem räumlich unterteilten Segmentblock auftritt, und die gesamte Segmentübergangsdynamikverhaltenseigenschaftsinformation (T) durch Berechnen einer Segmentübergangsdynamikverhaltenseigenschaftsinformation (ti) erzeugt (S318),

    wobei, in dem räumlichen Unterteilungssegmentdetektionsbetrieb, eine Dynamikbewegungspunktinformation (αi) erzeugt wird, und zwar, wann immer die Berührungsdaten für eine Position eingegeben werden, an welcher die Berührungsdaten auftreten, und für den Dynamikbewegungsverfolgungsbetrieb ausgegeben werden,

    wobei der handschriftliche Unterschriftseigenschaftserzeugungsbetrieb die handschriftliche Unterschriftseigenschaftsinformation (Σ), welche ferner die gesamt Segmentdynamikverhaltenseigenschaftsinformation (Ψ) und die gesamte Segmentübergangsdynamikverhaltenseigenschaftsinformation (T), zusätzlich zu der gesamten handschriftlichen Unterschriftsblockeigenschaftsinformation (Q), der gesamten Segmentblockeigenschaftsinformation (V), der gesamten Segmentblockpositionsinformation (P), und der gesamten Segmentblockkorrelationseigenschaftsinformation (C) aufweist, erzeugt und ausgibt (S119, S127).


     
    18. Das Verfahren nach Anspruch 17, wobei die Dynamikbewegungspunktinformation (αi) gemäß einer folgenden Gleichung 36 zusammengesetzt ist.


     
    19. Das Verfahren nach Anspruch 16, wobei die Segmentdynamikverhaltenseigenschaftsinformation (ψi), welche Dynamikverhaltenseigenschaften darstellt, gemäß Gleichung 37 zusammengesetzt ist,
    wobei die gesamte Segmentdynamikverhaltenseigenschaftsinformation (Ψ) gemäß Gleichung 38 zusammengesetzt ist.




     
    20. Das Verfahren nach Anspruch 16, wobei eine Segmentübergangsdynamikverhaltenseigenschaftsinformation (ti) zwischen dem räumlich unterteilten Segmenten gemäß Gleichung 39 zusammengesetzt ist,
    wobei eine gesamte Segmentübergangsdynamikverhaltenseigenschaftsinformation (T) gemäß Gleichung 40 zusammengesetzt ist.




     


    Revendications

    1. Système d'authentification d'une signature manuscrite sur la base d'un suivi de mouvement dynamique de segment de division spatiale, le système comprenant :

    une unité d'entrée de signature manuscrite (400) qui comporte une unité d'entrée tactile (420) configurée pour fournir en sortie des données tactiles, sous la forme de données d'entrée de signature manuscrite, comportant des données de position et des données de pression pour des positions qui sont touchées par un signataire pour une signature manuscrite ;

    une unité d'inscription (100) configurée pour inscrire des informations de caractéristiques de bloc de signature manuscrite globale (Σ) de chaque signataire ; et

    une unité d'authentification de signature manuscrite (500) configurée pour stocker les données d'entrée de signature manuscrite comportant les données tactiles reçues depuis l'unité d'entrée de signature manuscrite (400), générer une image de signature manuscrite en identifiant la signature manuscrite à l'aide des données d'entrée de signature manuscrite, générer un bloc spatial de signature manuscrite globale (S, S313) défini par des points haut, bas, le plus à gauche et le plus à droite de la signature manuscrite globale et comportant la signature manuscrite, générer des blocs de segment par la division spatiale du bloc de signature manuscrite globale (S) généré par un nombre de divisions prédéterminé (S317), détecter une image de segment pour chacun des blocs de segment (S323) générés, collecter les informations de caractéristiques de signature manuscrite (Σ) comportant les informations de bloc de signature manuscrite globale (S), des informations de chaque bloc de segment, des informations de corrélation entre le bloc de signature manuscrite globale (S) et chaque bloc de segment (S119), mettre en correspondance les informations de caractéristiques de signature manuscrite collectées avec des informations d'identification du signataire, inscrire les informations de caractéristiques de signature manuscrite collectées dans l'unité d'inscription (100, S121), collecter des informations de caractéristiques de signature manuscrite (Σ) comportant les informations de bloc de signature manuscrite globale (S), les informations de chaque bloc de segment, les informations de corrélation entre le bloc de signature manuscrite globale (S) et chaque bloc de segment à partir des données tactiles saisies par l'intermédiaire de l'unité d'entrée tactile (420) de l'unité d'entrée de signature manuscrite (400) (S127) lors de la réception d'une demande d'authentification de signature manuscrite (S113), charger les informations de caractéristiques de signature manuscrite inscrites (Σ') qui correspondent aux informations d'identification du signataire (S129) qui demande l'authentification de signature manuscrite, et réaliser l'authentification de signature manuscrite sur la base de segments de la signature manuscrite selon un taux de concordance (S133) par la comparaison des informations de caractéristiques de signature manuscrite inscrites (Σ', S131) aux informations de caractéristiques de signature manuscrite collectées (Σ).


     
    2. Système selon la revendication 1, dans lequel l'unité d'authentification de signature manuscrite (500) comprend :

    une unité d'extraction de caractéristiques de signature manuscrite (520) configurée pour stocker les données d'entrée de signature manuscrite reçues par l'intermédiaire de l'unité d'entrée tactile (420) de l'unité d'entrée de signature manuscrite (400), générer l'image de signature manuscrite par l'identification de la signature manuscrite à l'aide des données d'entrée de signature manuscrite, générer le bloc de signature manuscrite globale (S) comportant la signature manuscrite (S313), générer les blocs de segment par la division spatiale du bloc de signature manuscrite globale (S) généré par le nombre de divisions prédéterminé (S317), détecter l'image de segment de chacun des blocs de segment générés (S323), et extraire les informations de caractéristiques de signature manuscrite (Σ) comportant des informations de caractéristiques de bloc de signature manuscrite globale (Q) du bloc de signature manuscrite globale (S), des informations de caractéristiques de bloc de segment global (V) des blocs de segment constituant la signature manuscrite, des informations de position de bloc de segment global (P) des blocs de segment comportant des informations de position de bloc de sous-segment, et des informations de caractéristiques de corrélation de bloc de segment global (C) comportant les informations de corrélation entre le bloc de signature manuscrite globale (S) et chaque bloc de segment (S249) ;

    une unité d'authentification de bloc de segment de signature manuscrite (560) configurée pour réaliser une authentification de signature manuscrite selon un taux de concordance prédéterminé (S133) par la comparaison des informations de caractéristiques de signature manuscrite (Σ, S131) extraites par l'unité d'extraction de caractéristiques de signature manuscrite (520) aux informations de caractéristiques de signature manuscrite pré-inscrites (Σ') ; et

    une unité de commande (510) configurée pour sauvegarder et inscrire les informations de caractéristiques de signature manuscrite (S121) extraites par l'unité d'extraction de caractéristiques de signature manuscrite (520) dans l'unité d'inscription (100) lors de la réception d'une demande d'inscription, et réaliser une authentification de signature manuscrite par la commande de l'unité d'authentification de bloc de segment de signature manuscrite (560) lors de la réception de la demande d'authentification de signature manuscrite.


     
    3. Système selon la revendication 2, dans lequel l'unité d'extraction de caractéristiques de signature manuscrite (520) comprend :

    une unité de détection de début de signature manuscrite (610) configurée pour détecter un début de la signature manuscrite à partir des données tactiles ;

    une unité de détection de fin de signature manuscrite (620) configurée pour détecter une fin de la signature manuscrite par la désignation d'un point d'entrée de données tactiles final sous la forme d'un point de fin de la signature manuscrite lorsqu'il n'y a pas d'entrée de données tactiles pendant une certaine période après la saisie des données tactiles ;

    une unité de détection de segment de division spatiale (630) configurée pour générer l'image de signature manuscrite par l'identification de la signature manuscrite à l'aide des données d'entrée de signature manuscrite reçues par l'intermédiaire de l'unité d'entrée tactile (420), générer le bloc de signature manuscrite globale (S) comportant la signature manuscrite (S313), générer les blocs de segment par la division spatiale du bloc de signature manuscrite globale (S) généré par le nombre de divisions prédéterminé (S317), et détecter l'image de segment pour chacun des blocs de segment générés (S323) ;

    une unité de comptage de segment (640) configurée pour compter un nombre de sous-segments détectés par l'unité de détection de segment de division spatiale (630) (S222) ;

    une unité de détection de caractéristiques de bloc de segment de division spatiale (650) configurée pour recevoir l'image de segment, déterminer si l'image de segment est divisée, générer un bloc de sous-segment (śi.x, S327) comportant le sous-segment lorsqu'une image de sous-segment re-segmentée à partir de l'image de segment est détectée, générer des informations de caractéristiques de bloc de segment (vi, S225) et des informations de caractéristiques de bloc de sous-segment (v́i, S235, S237, S239) pour le bloc de segment (si) et le bloc de sous-segment (i.x) , respectivement, et générer (S249) et fournir en sortie les informations de caractéristiques de bloc de segment global (V) comportant les informations de caractéristiques de bloc de segment (vi) et les informations de caractéristiques de bloc de sous-segment (v́i) avec les informations de position de bloc de segment global (P) ;

    une unité de détection de caractéristiques de bloc de signature manuscrite globale (660) configurée pour générer (S249) et fournir en sortie les informations de caractéristiques de bloc de signature manuscrite globale (Q) du bloc de signature manuscrite globale (S) ;

    une unité de détection de corrélation de bloc de sous-segment (670) configurée pour générer (S249) et fournir en sortie les informations de caractéristiques de corrélation de bloc de segment global (C) comportant des informations de corrélation entre au moins deux éléments parmi le bloc de signature manuscrite globale (S), le bloc de segment, et les blocs de sous-segment ; et

    une unité d'acquisition de caractéristiques de signature manuscrite (550) comportant une unité de génération d'informations de caractéristiques de signature manuscrite (680) configurée pour générer (S119, S127) et fournir en sortie les informations de caractéristiques de signature manuscrite (Σ) comportant les informations de caractéristiques de bloc de signature manuscrite globale (Q), les informations de caractéristiques de bloc de segment global (V), les informations de position de bloc de segment global (P), et les informations de caractéristiques de corrélation de bloc de segment global (C).


     
    4. Système selon la revendication 3, dans lequel l'unité de détection de caractéristiques de bloc de signature manuscrite globale (660) génère et fournit en sortie en outre des informations d'espace de bloc de signature manuscrite globale (espace(S)) par le calcul de zone d'espace du bloc de signature manuscrite globale (S) (S217),
    dans lequel l'unité de détection de caractéristiques de bloc de segment de division spatiale (650) comprend :

    une unité de génération de bloc de sous-segment (651) configurée pour recevoir l'image de segment en tant qu'entrée, déterminer si l'image de segment est divisée, et générer le bloc de sous-segment (i.x) comportant le sous-segment lorsque l'image de sous-segment re-segmentée à partir de l'image de segment est détectée (S327) ;

    une unité de détection de position de bloc de segment (652) configurée pour recevoir le bloc de segment (si) et le bloc de sous-segment (śi.x), et détecter et fournir en sortie des informations de position de bloc de segment (pi) et les informations de position de bloc de sous-segment (ṕi.x) qui représentent des bords du bloc de segment et des blocs de sous-segment (S329), respectivement ;

    une unité de détection de caractéristiques d'espace de bloc de segment (653) configurée pour recevoir au moins un élément parmi le bloc de segment (si), le bloc de sous-segment (i-x) , les informations de position de bloc de segment (pi), et les informations de position de bloc de sous-segment (ṕi.x) et générer et fournir en sortie des informations d'espace de bloc de segment (espace (si)) et des informations d'espace de bloc de sous-segment (espace (i.x)) par le calcul de zones d'espace du bloc de segment (si) et du bloc de sous-segment (i.x) (S331) ;

    une unité de détection de caractéristiques de rapport d'espace (654) configurée pour recevoir les informations d'espace de bloc de signature manuscrite globale (espace(S)), les informations d'espace de bloc de segment (espace(si)), et des informations d'espace de bloc de sous-segment (espace (i.x)) depuis l'unité de détection de caractéristiques de bloc de signature manuscrite globale (660), calculer un rapport entre un espace de bloc de segment et un espace de bloc de signature manuscrite globale, un rapport entre un espace de bloc de sous-segment et l'espace de bloc de signature manuscrite globale, et un rapport entre l'espace de bloc de sous-segment et l'espace de bloc de segment, et générer et fournir en sortie au moins un élément parmi des informations de rapport (Δi) entre l'espace de bloc de segment et l'espace de bloc de signature manuscrite globale, des informations de rapport (Δ́i.x) entre l'espace de bloc de sous-segment et l'espace de bloc de signature manuscrite globale, et des informations de rapport (έi.x) entre l'espace de bloc de sous-segment et l'espace de bloc de segment (S223) ; et

    une unité de génération d'informations de caractéristiques de bloc de segment (655) configurée pour générer les informations de caractéristiques de bloc de segment (vi) et les informations de caractéristiques de bloc de sous-segment (i) comportant des informations correspondantes sélectionnées parmi : les informations de position de bloc de segment (pi) de chaque segment de la signature manuscrite, les informations de position de bloc de sous-segment (ṕi.x), les informations d'espace de bloc de segment (espace(si)), les informations d'espace de bloc de sous-segment (espace (śi.x)), les informations de rapport (Δi) entre l'espace de bloc de segment et l'espace de bloc de signature manuscrite globale, les informations de rapport (Δ́i.x) entre l'espace de bloc de sous-segment et l'espace de bloc de signature manuscrite globale, et les informations de rapport (έi.x) entre l'espace de bloc de sous-segment et l'espace de bloc de segment, et générer et fournir en sortie les informations de caractéristiques de bloc de segment global (V) pour tous les blocs de segment de la signature manuscrite (S119, S127).


     
    5. Système selon la revendication 4, dans lequel le bloc est un polygone,
    dans lequel l'unité de génération de bloc de sous-segment (651) génère un bloc de sous-segment de polygone entourant le segment par le passage par des points haut, bas, le plus à gauche, et le plus à droite du sous-segment.
     
    6. Système selon la revendication 4, dans lequel l'unité de détection de corrélation de bloc de sous-segment (670) comprend :

    une unité de détection d'espace d'intersection (671) configurée pour détecter tout bloc de sous-segment adjacent (i.y) ayant une relation d'inclusion ou d'intersection avec le bloc de sous-segment (śi.x), et fournir en sortie, le cas échéant, des informations d'espace d'intersection (δ́i.xy) par le calcul d'une zone d'espace d'inclusion ou d'intersection (S229) ;

    une unité de détection de rapport d'espace d'intersection (672) configurée pour recevoir les informations d'espace de bloc de signature manuscrite globale (espace(S)), les informations d'espace de bloc de segment (espace (si)), les informations d'espace de bloc de sous-segment (espace (śi.x)), et les informations d'espace d'intersection de bloc de sous-segment (δ́i.xy), générer les informations de rapport (i.xy) entre l'espace d'intersection de bloc de sous-segment et l'espace de bloc de signature manuscrite globale par le calcul d'un rapport entre l'espace d'intersection de bloc de sous-segment (δ́i.xy) et l'espace de bloc de signature manuscrite globale (espace (S)), générer des informations de rapport (π́i(δ́ij)) entre l'espace d'intersection de bloc de sous-segment et l'espace de bloc de sous-segment par le calcul d'un rapport entre l'espace d'intersection de bloc de sous-segment (δ́i.xy) et l'espace de bloc de sous-segment (espace (i.x)), et générer des informations de rapport (π́i(δ́ij)) entre l'espace d'intersection de bloc de sous-segment et un espace de bloc de sous-segment adjacent par le calcul d'un rapport entre l'espace d'intersection de bloc de sous-segment (δ́i.xy) et l'espace de bloc de sous-segment adjacent (espace (i.y) (S223, S231, S232) ;

    une unité de détection de relation d'inclusion de bloc de segment (673) configurée pour générer et fournir en sortie des informations de relation d'inclusion de bloc de sous-segment (ói.xy) qui montrent si le bloc de sous-segment adjacent (śi.y) est inclus dans le bloc de sous-segment (śi.x) ou en intersection avec celui-ci (S235) ;

    une unité de détection de relation positionnelle de segment configurée pour générer et fournir en sortie des informations de relation positionnelle de bloc de sous-segment (pósi.xy) représentant une position relative du bloc de sous-segment adjacent (śi.y) par rapport au bloc de sous-segment (śi.x) (S237) ;

    une unité de détection de relation positionnelle de bord (675) configurée pour générer et fournir en sortie des informations de relation positionnelle de bord de bloc de sous-segment (bordi.xy) représentant une position de bord relative à laquelle un bord du bloc de sous-segment (śi.x) est en intersection avec le bloc de sous-segment adjacent (śi.y) (S239) ; et

    une unité de génération d'informations de caractéristiques de corrélation (677) configurée pour générer et fournir en sortie des informations de caractéristiques de corrélation de bloc de segment global (C) comportant les informations d'espace d'intersection de bloc de sous-segment (δ́i.xy), les informations de rapport (i.xy) entre l'espace d'intersection de bloc de sous-segment et l'espace de bloc de signature manuscrite globale, les informations de rapport (π́i(δ́ij)) entre l'espace d'intersection de bloc de sous-segment et l'espace de bloc de sous-segment, les informations de rapport (π́j(δ́ij))) entre l'espace d'intersection de bloc de sous-segment et l'espace de bloc de sous-segment adjacent, les informations de relation d'inclusion de bloc de sous-segment i-xy), les informations de relation positionnelle de bloc de sous-segment (pósi.xy), et les informations de relation positionnelle de bord de bloc de sous-segment (bordi.xy) (S249) .


     
    7. Système selon la revendication 3, dans lequel l'unité d'extraction de caractéristiques de signature manuscrite (520) comprend :

    une unité de suivi de mouvement dynamique (690) configurée pour générer des informations de caractéristiques comportementales dynamiques de segment global (Ψ) par le calcul d'informations de caractéristiques comportementales dynamiques de segment (Ψi) représentant des caractéristiques comportementales dynamiques produites par l'intermédiaire d'un mouvement dynamique de la signature manuscrite sur la base d'informations de point de mouvement dynamique (αi) reçues dans le bloc de segment divisé spatialement et générer des informations de caractéristiques comportementales dynamiques de transition de segment global (T) par le calcul d'informations de caractéristiques comportementales dynamiques de transition de segment (ti) (S318),

    dans lequel l'unité de détection de segment de division spatiale (630) génère les informations de point de mouvement dynamique (αi), chaque fois que les données tactiles sont fournies en entrée, pour une position à laquelle les données tactiles se produisent et fournit en sortie les informations de point de mouvement dynamique (αi) à l'unité de suivi de mouvement dynamique (690),

    dans lequel l'unité d'acquisition de caractéristiques de signature manuscrite (550) génère et fournit en sortie les informations de caractéristiques de signature manuscrite (Σ) comportant en outre les informations de caractéristiques comportementales dynamiques de segment global (Ψ) et les informations de caractéristiques comportementales dynamiques de transition de segment global (T) en plus des informations de caractéristiques de bloc de signature manuscrite globale (Q), des informations de caractéristiques de bloc de segment global (V), des informations de position de bloc de segment global (P), et des informations de caractéristiques de corrélation de bloc de segment global (C) (S119, S127).


     
    8. Système selon la revendication 7, dans lequel les informations de point de mouvement dynamique (αi) sont composées selon une équation 31 suivante.


     
    9. Système selon la revendication 1, dans lequel les informations de caractéristiques comportementales dynamiques de segment (Ψi) représentant des caractéristiques comportementales dynamiques sont composées selon l'équation 32,
    dans lequel les informations de caractéristiques comportementales dynamiques de segment global (Ψ) sont composées selon l'équation 33.




     
    10. Système selon la revendication 1, dans lequel des informations de caractéristiques comportementales dynamiques de transition de segment (ti) entre les segments de division spatiale sont composées selon l'équation 34,
    dans lequel les informations de caractéristiques comportementales dynamiques de transition de segment global (T) sont composées selon l'équation 35.




     
    11. Procédé d'authentification d'une signature manuscrite basée sur un suivi de mouvement dynamique de segment de division spatiale, le procédé comprenant :

    un processus d'inscription consistant à inscrire des informations de caractéristiques de bloc de signature manuscrite globale de chaque signataire ;

    stocker des données d'entrée de signature manuscrite comportant des données tactiles reçues depuis une unité d'entrée de signature manuscrite (400), les données tactiles comportant des données de position et des données de pression pour des positions qui sont touchées par un signataire pour une signature manuscrite ;

    générer une image de signature manuscrite par l'identification de la signature manuscrite à l'aide des données d'entrée de signature manuscrite, générer un bloc spatial de signature manuscrite globale (S) (S313) défini par des points haut, bas, le plus à gauche et le plus à droite de la signature manuscrite globale et comportant la signature manuscrite, générer des blocs de segment par la division spatiale du bloc de signature manuscrite globale (S) généré par un nombre de divisions prédéterminé (S317), détecter une image de segment pour chacun des blocs de segment générés (S323), collecter des informations de caractéristiques de signature manuscrite (Σ) comportant les informations de bloc de signature manuscrite globale (S), les informations de chaque bloc de segment, les informations de corrélation entre le bloc de signature manuscrite globale (S) et chaque bloc de segment (S119), mettre en correspondance les informations de caractéristiques de signature manuscrite collectées avec des informations d'identification du signataire, et inscrire les informations de caractéristiques de signature manuscrite collectées dans une unité d'inscription (100, S121) ; et

    un processus d'authentification de signature manuscrite consistant à collecter des informations de caractéristiques de signature manuscrite (Σ) comportant les informations de bloc de signature manuscrite globale (S), les informations de chaque bloc de segment, les informations de corrélation entre le bloc de signature manuscrite globale (S) et chaque bloc de segment à partir des données tactiles saisies par l'intermédiaire d'une unité d'entrée tactile (420) d'une unité d'entrée de signature manuscrite (400) (S127) lors d'une demande d'authentification de signature manuscrite (S113), charger les informations de caractéristiques de signature manuscrite inscrites (Σ') qui correspondent aux informations d'identification du signataire (S129) qui demande l'authentification de signature manuscrite, et réaliser l'authentification de signature manuscrite sur la base de segments de la signature manuscrite selon un taux de concordance (S133) par la comparaison des informations de caractéristiques de signature manuscrite inscrites (Σ') aux informations de caractéristiques de signature manuscrite collectées (Σ, S131).


     
    12. Procédé selon la revendication 11, dans lequel le processus d'inscription comprend :

    une opération de surveillance de demande d'inscription qui surveille si une demande d'inscription de signature manuscrite est formulée (S111) ;

    une opération d'acquisition d'informations d'identification de signataire qui acquiert les informations d'identification de signataire à inscrire lors de la demande d'inscription de signature manuscrite (S115) ;

    une opération d'acquisition d'informations de caractéristiques de signature manuscrite qui acquiert les informations de caractéristiques de signature manuscrite (Σ) à partir de données tactiles saisies par l'intermédiaire de l'unité d'entrée tactile (420) concernant la signature manuscrite du signataire (S119) ; et

    une opération d'inscription de signature manuscrite qui met en correspondance les informations de caractéristiques de signature manuscrite avec les informations d'identification du signataire et inscrit les informations de caractéristiques de signature manuscrite dans l'unité d'inscription (100, S121).


     
    13. Procédé selon la revendication 11, dans lequel le processus d'authentification de signature manuscrite comprend :

    une opération de surveillance de demande d'authentification de signature manuscrite qui surveille si la demande d'authentification de signature manuscrite est formulée (S113) ;

    une opération d'acquisition d'informations d'identification de signataire qui acquiert les informations d'identification de signataire lors de la réception de la demande d'authentification de signature manuscrite (S125) ;

    une opération d'acquisition d'informations de caractéristiques de signature manuscrite qui acquiert les informations de caractéristiques de signature manuscrite (Σ) à partir des données tactiles reçues par l'intermédiaire de l'unité d'entrée tactile pour la signature manuscrite du signataire (S127) ;

    une opération de chargement d'informations de caractéristiques de signature manuscrite inscrites qui charge les informations de caractéristiques de signature manuscrite pré-inscrites (Σ') correspondant aux informations d'identification de signataire acquises (S129) ; et

    une opération d'authentification de signature manuscrite qui réalise une authentification de signature manuscrite par la comparaison des informations de caractéristiques de signature manuscrite acquises (Σ) aux informations de caractéristiques de signature manuscrite inscrites (Σ') telles que chargées et fournit en sortie un résultat de l'authentification (S131).


     
    14. Procédé selon la revendication 12 ou 13, dans lequel l'opération d'acquisition d'informations de caractéristiques de signature manuscrite (Σ) comprend :

    une opération de suivi de signature manuscrite qui commence le suivi de la signature manuscrite à partir des données tactiles des données d'entrée de signature manuscrite saisies par l'intermédiaire de l'unité d'entrée de signature manuscrite (400) ;

    une opération de détection de segment qui génère l'image de signature manuscrite par l'identification de la signature manuscrite à l'aide des données d'entrée de signature manuscrite reçues par l'intermédiaire de l'unité d'entrée tactile (420), génère le bloc de signature manuscrite globale (S) comportant la signature manuscrite (S313), génère les blocs de segment par la division spatiale du bloc de signature manuscrite globale (S) par le nombre de divisions prédéterminé (S317), et détecte et fournit en sortie l'image de segment de chacun des blocs de segment (S323) ;

    une opération de comptage de segment qui compte un nombre des sous-segments détectés dans l'opération de détection de segment de division spatiale (S222) ;

    une opération de détection de caractéristiques de bloc de segment qui reçoit l'image de segment, détermine si l'image de segment est divisée, génère un bloc de sous-segment (śi.x, S327) comportant le sous-segment lorsqu'une image de sous-segment re-segmentée à partir de l'image de segment est détectée, génère des informations de caractéristiques de bloc de segment (vi, S225) et des informations de caractéristiques de bloc de sous-segment (v́i, S235, S237, S239) pour le bloc de segment (si) et le bloc de sous-segment (i.x) , respectivement, et génère (S249) et fournit en sortie des informations de caractéristiques de bloc de segment global (V) comportant les informations de caractéristiques de bloc de segment (vi) et les informations de caractéristiques de bloc de sous-segment (v́i);

    une opération de détection de caractéristiques de bloc de signature manuscrite globale qui génère (S249) et fournit en sortie des informations de caractéristiques de bloc de signature manuscrite globale (Q) du bloc de signature manuscrite globale (S) ;

    une opération de détection de corrélation de bloc de segment qui génère et fournit en sortie les informations de caractéristiques de corrélation de bloc de segment global (C) comportant des informations de corrélation entre au moins deux éléments parmi le bloc de signature manuscrite globale (S), le bloc de segment, et les blocs de sous-segment (S249) ; et

    une opération de génération d'informations de caractéristiques de signature manuscrite qui génère les informations de caractéristiques de bloc de segment global (V) comportant les informations de caractéristiques de bloc de segment (vi) et les informations de caractéristiques de bloc de sous-segment (i) pour tous les segments et les sous-segments, respectivement, et génère et fournit en sortie les informations de caractéristiques de signature manuscrite (Σ) comportant les informations de caractéristiques de bloc de signature manuscrite globale (Q), les informations de caractéristiques de bloc de segment global (V) (S249), les informations de position de bloc de segment global (P) des blocs de segment générés (S319) comportant des informations de position de bloc de sous-segment, des informations de caractéristiques de corrélation de bloc de segment global (C), et des informations de caractéristiques comportementales dynamiques de segment global (Ψ) (S318) .


     
    15. Procédé selon la revendication 14, dans lequel l'opération de détection de caractéristiques de bloc de signature manuscrite globale génère et fournit en sortie en outre des informations d'espace de bloc de signature manuscrite globale (espace(S)) par le calcul de zone d'espace du bloc de signature manuscrite globale (S) (S217),
    dans lequel l'opération de détection de caractéristiques de bloc de segment comprend :

    une opération de génération de bloc de sous-segment qui reçoit l'image de segment en tant qu'entrée, détermine si l'image de segment est divisée, et génère et fournit en sortie le bloc de sous-segment (śi.x) comportant le sous-segment lorsque l'image de sous-segment re-segmentée à partir de l'image de segment est détectée (S327) ;

    une opération de détection de position de bloc de segment qui reçoit le bloc de segment (si) et le bloc de sous-segment (i.x), et détecte et fournit en sortie des informations de position de bloc de segment (pi) et les informations de position de bloc de sous-segment (i.x) qui représentent des bords du bloc de segment et des blocs de sous-segment, respectivement (S329) ;

    une opération de détection de caractéristiques d'espace de bloc de segment qui reçoit au moins un élément parmi le bloc de segment (si), le bloc de sous-segment (i.x) , les informations de position de bloc de segment (pi), et les informations de position de bloc de sous-segment (i.x) et génère et fournit en sortie des informations d'espace de bloc de segment (espace (si)) et des informations d'espace de bloc de sous-segment (espace (i.x)) par le calcul de zones d'espace du bloc de segment (si) et du bloc de sous-segment (śi.x) (S331) ;

    une opération de détection de caractéristiques de rapport d'espace qui reçoit les informations d'espace de bloc de signature manuscrite globale (espace(S)), les informations d'espace de bloc de segment (espace(si)), et des informations d'espace de bloc de sous-segment (espace (i.x), calcule un rapport entre un espace de bloc de segment et un espace de bloc de signature manuscrite globale, un rapport entre un espace de bloc de sous-segment et l'espace de bloc de signature manuscrite globale, et un rapport entre l'espace de bloc de sous-segment et l'espace de bloc de segment, et génère et fournit en sortie au moins un élément parmi des informations de rapport (Δi) entre l'espace de bloc de segment et l'espace de bloc de signature manuscrite globale, des informations de rapport (Δ́i-x) entre l'espace de bloc de sous-segment et l'espace de bloc de signature manuscrite globale, et des informations de rapport (έi.x) entre l'espace de bloc de sous-segment et l'espace de bloc de segment (S223) ; et

    une opération de génération d'informations de caractéristiques de bloc de segment qui génère les informations de caractéristiques de bloc de segment (vi) et les informations de caractéristiques de bloc de sous-segment (i) comportant des informations correspondantes sélectionnées parmi : les informations de position de bloc de segment (pi) de chaque segment de la signature manuscrite, les informations de position de bloc de sous-segment (i.x), les informations d'espace de bloc de segment (espace(si)), les informations d'espace de bloc de sous-segment (espace (i.x)), les informations de rapport (Δi) entre l'espace de bloc de segment et l'espace de bloc de signature manuscrite globale, les informations de rapport (Δ́i.x) entre l'espace de bloc de sous-segment et l'espace de bloc de signature manuscrite globale, et les informations de rapport (έi.x) entre l'espace de bloc de sous-segment et l'espace de bloc de segment, et génère et fournit en sortie les informations de caractéristiques de bloc de segment global (V) pour tous les blocs de segment de la signature manuscrite (S119, S127).


     
    16. Procédé selon la revendication 15, dans lequel l'opération de détection de corrélation de bloc de segment comprend :

    une opération de détection d'espace d'intersection qui détecte tout bloc de sous-segment adjacent (i.y) ayant une relation d'inclusion ou d'intersection avec le bloc de sous-segment (i.x), et fournit en sortie, le cas échéant, des informations d'espace d'intersection (δ́i.xy) par le calcul d'une zone d'espace d'inclusion ou d'intersection (S229) ;

    une opération de détection de rapport d'espace d'intersection qui reçoit les informations d'espace de bloc de signature manuscrite globale (espace(S)), les informations d'espace de bloc de segment (espace(si)), les informations d'espace de bloc de sous-segment (espace(i.x)), et les informations d'espace d'intersection de bloc de sous-segment (δ́i.xy), génère les informations de rapport (i.xy) entre l'espace d'intersection de bloc de sous-segment et l'espace de bloc de signature manuscrite globale par le calcul d'un rapport entre l'espace d'intersection de bloc de sous-segment (δ́i.xy) et l'espace de bloc de signature manuscrite globale (espace (S)), génère des informations de rapport (π́i(δ́ij)) entre l'espace d'intersection de bloc de sous-segment et l'espace de bloc de sous-segment par le calcul d'un rapport entre l'espace d'intersection de bloc de sous-segment (δ́i.xy) et l'espace de bloc de sous-segment (espace (i.x)), et génère des informations de rapport (π́j(δ́ij)) entre l'espace d'intersection de bloc de sous-segment et un espace de bloc de sous-segment adjacent par le calcul d'un rapport entre l'espace d'intersection de bloc de sous-segment (δ́i.xy) et l'espace de bloc de sous-segment adjacent (espace(i.y) (S223, S231, S232) ;

    une opération de détection de relation d'inclusion de bloc de segment qui génère et fournit en sortie des informations de relation d'inclusion de bloc de sous-segment (i.xy) qui montrent si le bloc de sous-segment adjacent (i.y) est inclus dans le bloc de sous-segment (i.x) ou en intersection avec celui-ci (S237) ;

    une opération de détection de relation positionnelle de segment qui génère et fournit en sortie des informations de relation positionnelle de bloc de sous-segment (pósi.xy) représentant une position relative du bloc de sous-segment adjacent (i.y) par rapport au bloc de sous-segment (i.x) (S239) ;

    une opération de détection de relation positionnelle de bord qui génère et fournit en sortie des informations de relation positionnelle de bord de bloc de sous-segment (ed́gei.xy) représentant une position de bord relative à laquelle un bord du bloc de sous-segment (i.x) est en intersection avec le bloc de sous-segment adjacent (i.y) (S239) ; et

    une opération de génération d'informations de caractéristiques de corrélation qui génère et fournit en sortie des informations de caractéristiques de corrélation de bloc de segment global (C) comportant les informations d'espace d'intersection de bloc de sous-segment (δ́i.xy), les informations de rapport (i.xy) entre l'espace d'intersection de bloc de sous-segment et l'espace de bloc de signature manuscrite globale, les informations de rapport (π́i(δ́ij)) entre l'espace d'intersection de bloc de sous-segment et l'espace de bloc de sous-segment, les informations de rapport (π́j(δ́ij)) entre l'espace d'intersection de bloc de sous-segment et l'espace de bloc de sous-segment adjacent, les informations de relation d'inclusion de bloc de sous-segment (i.xy), les informations de relation positionnelle de bloc de sous-segment (pósi.xy), et les informations de relation positionnelle de bord de bloc de sous-segment (ed́gei.xy) (S249) .


     
    17. Procédé selon la revendication 14, dans lequel l'opération d'acquisition d'informations de caractéristiques de signature manuscrite comprend :

    une opération de suivi de mouvement dynamique qui génère des informations de caractéristiques comportementales dynamiques de segment global (Ψ) par le calcul d'informations de caractéristiques comportementales dynamiques de segment (ψi) représentant des caractéristiques comportementales dynamiques qui se sont produites par l'intermédiaire d'un mouvement dynamique de la signature manuscrite sur la base d'informations de point de mouvement dynamique (αi) reçues dans le bloc de segment divisé spatialement et génère des informations de caractéristiques comportementales dynamiques de transition de segment global (T) par le calcul d'informations de caractéristiques comportementales dynamiques de transition de segment (ti) (S318),

    dans lequel, dans l'opération de détection de segment de division spatiale, des informations de point de mouvement dynamique (αi) sont générées chaque fois que les données tactiles sont fournies en entrée pour une position à laquelle les données tactiles se produisent et sont fournies en sortie pour l'opération de suivi de mouvement dynamique,

    dans lequel l'opération de génération de caractéristiques de signature manuscrite génère et fournit en sortie les informations de caractéristiques de signature manuscrite (Σ) comportant en outre les informations de caractéristiques comportementales dynamiques de segment global (Ψ) et les informations de caractéristiques comportementales dynamiques de transition de segment global (T) en plus des informations de caractéristiques de bloc de signature manuscrite globale (Q), des informations de caractéristiques de bloc de segment global (V), des informations de position de bloc de segment global (P), et des informations de caractéristiques de corrélation de bloc de segment global (C) (S119, S127).


     
    18. Procédé selon la revendication 17, dans lequel les informations de point de mouvement dynamique (αi) sont composées selon une équation 36 suivante.


     
    19. Procédé selon la revendication 16, dans lequel les informations de caractéristiques comportementales dynamiques de segment (ψi) représentant des caractéristiques comportementales dynamiques sont composées selon l'équation 37,
    dans lequel les informations de caractéristiques comportementales dynamiques de segment global (Ψ) sont composées selon l'équation 38.




     
    20. Procédé selon la revendication 16, dans lequel des informations de caractéristiques comportementales dynamiques de transition de segment (ti) entre les segments de division spatiale sont composées selon l'équation 39,
    dans lequel des informations de caractéristiques comportementales dynamiques de transition de segment global (T) sont composées selon l'équation 40.




     




    Drawing















































    Cited references

    REFERENCES CITED IN THE DESCRIPTION



    This list of references cited by the applicant is for the reader's convenience only. It does not form part of the European patent document. Even though great care has been taken in compiling the references, errors or omissions cannot be excluded and the EPO disclaims all liability in this regard.

    Patent documents cited in the description