BACKGROUND OF THE INVENTION
Field of the Invention
[0001] The present invention pertains generally to a receptor protein tyrosine kinase (rPTK)
ligand. More particularly, the invention relates to a novel ligand. designated VEGF-related
protein (VRP) or VH1, which binds to, and stimulates the phosphorylation of. the Flt4
tyrosine kinase receptor (also known as the Sal-S1 receptor) and the isolation and
recombinant production of the same.
Description of Related Art
[0002] The formation of new blood vessels either from differentiating endothelial cells
during embryonic development (vasculogenesis) or from pre-existing vessels during
adult life (angiogenesis) is an essential feature of organ development, reproduction,
and wound healing in higher organisms. Folkman and Shing,
J. Biol. Chem.,
267: 10931-10934 (1992); Reynolds
et al.,
FASEB J.,
6: 886-892 (1992); Risau
et al.,
Development, 102: 471-478 (1988). Angiogenesis is also necessary for certain pathological processes
including tumorigenesis (Folkman,
Nature Medicine,
1:27-31 [1995]) and retinopathy. Miller
et al.,
Am. J. Pathol.,
145:574-584 (1994).
[0003] While several growth factors can stimulate angiogenesis (Klagsbrun and D'Amore,
Ann. Rev. Physiol.,
53: 217-239 [1991]; Folkman and Klagsbrun,
Science,
235:442-447[1987]), vascular endothelial growth factor (VEGF) (Ferrara
et al.,
Endo. Rev.,
13: 18-32 [1992]) is a potent angiogenic factor that acts via the endothelial cell-specific
receptor tyrosine kinases
fms-like tyrosine kinase (Flt1) (Shibuya
et al.,
Oncogene,
5: 519-524 [1990]; de Vries
et al.,
Science,
255: 989-991[1992]) and fetal liver kinase (Flk1)(also designated KDR). Quinn
et al.,
Proc. Natl. Acad. Sci. USA,
90: 7533-7537(1993); Millauer
et al.,
Cell 72: 835-846 (1993); Matthews
et al.,
Proc. Natl. Acad. Sci. USA. 88: 9026-9030(1991); Terman
et al.,
Biochem, Biophys, Res, Commun, 187: 1579-1586(1992); Terman
et al.,
Oncogene,
6: 1677-1683 (1991); Oelrichs
et al.,
Oncogene,
8: 11-18(1993). These two VEGF receptors and a third orphan receptor, Flt4 (Pajusola
et al.,
Cancer Res.,
52: 5738-5743 [1992]; Galland
et al.,
Oncogene,
8: 1233-1240 [1993]; Finnerty
et al.,
Oncogene,
8: 2293-2298[1993]) constitute a subfamily of class III receptor tyrosine kinases that
contain seven extracellular immunoglobulin-like domains and a split intracellular
tyrosine kinase domain. Mustonen and Alitalo,
J. Cell. Biol., 129: 895-898 (1995). See also WO94/10202 published 11 May 1994 and PCT/US93/00586 filed
22 January 1993 (Avraham
et al.). These three receptors have 31-36% amino acid identity in their extracellular ligand-binding
domains.
[0004] Mice deficient in Flt1 (Fong
et al.,
Nature,
376: 66-70 [1995]) or Flk1 (Shalaby
et al.,
Nature,
376: 62-66[1995]) (generated by gene targeting in embryonic stem cells) have severe defects
in vasculogenesis and die in utero at embryonic day 8-9. The phenotype of the receptor-deficient
mice differs considerably, however. Mice lacking Flt1 have a disorganized vascular
endothelium that extends to the major vessels as well as to the microvasculature,
while endothelial cell differentiation appears to be normal. Fong
et al.,
supra. Mice lacking Flk1 have a major defect in the development of mature endothelial cells
as well as a severe reduction in hematopoietic cell progenitors. Shalaby
et al.,
supra. Thus. VEGF may act on endothelial cells at more than one stage of vasculogenesis.
[0005] Flt4 is also specifically expressed in endothelial cells: it is first observed in
day 8.5 mouse embryos in endothelial cell precursors. Kaipainen
et al.,
Proc. Natl. Acad. Sci. USA. 92: 3566-3570 (1995); Kaipainen
et al.,
J. Exp. Med.,
178: 2077-2088 (1993). See also Hatva
et al.,
Am J. Pathol.,
146: 368-378 (1995). As development proceeds. Flt4 expression becomes confined to the
venous and lymphatic endothelium and is finally restricted to the lymphatic vessels.
Consistent with this finding, adult human tissues show Flt4 expression in lymphatic
endothelia while there is a lack of expression in arteries, veins, and capillaries.
Kaipainen
et al.,
Proc. Natl. Acad. Sci. USA.
supra. Clones encoding human and mouse Flt4 have been isolated either by PCR with primers
from conserved tyrosine kinase regions (Finnerty
et al.,
supra; PCT/US93/00586,
supra; Aprelikova
et al.,
Cancer Res.,
52: 746-748 [1992]) or by low-stringency hybridization with a Flk2 probe. Galland
et al.,
Genomics,
13: 475-478 (1992). Alternative splicing of the Flt4 mRNA produces two variants of the
protein differing by 65 amino acids at the C-terminus. Pajusola
et al.,
Oncogene, 8: 2931-2937 (1993). These variants migrate as bands of 170-190 kDa that are partially
cleaved proteolytically in the extracellular domain to produce a form of about 125
kDa. Pajusola
et al.,
Oncogene, 8,
supra; Pajusola
et al.,
Oncogene,
9: 3545-3555(1994). Expression of the longer spliced form of Flt4 as a chimera with
the extracellular domain of the CSF-1 receptor shows that the Flt4 intracellular domain
can signal a ligand-dependent growth response in rodent fibroblasts. Pajusola
et al.,
Oncogene,
9,
supra; Borg
et al.,
Oncogene,
10: 973-984 (1995). Flt4 has been localized to human chromosome 5q34-q35 (Aprelikova
et al.,
supra; Galland
et al.,
Genomics,
supra); Flt1 and Flk1 are located at 13q12 (Imbert
et,
al.,
Cytogenet, Cell Genet.,
67: 175-177[1994]) and 4q12. Sait
et al.,
Cytogenet,
Cell Genet.,
70: 145-146(1995); Spritz
et al.,
Genomics,
22: 431-436 (1994).
[0006] VEGF is a homodimeric, cysteine-rich protein that can occur in at least four forms
due to alternative splicing of its mRNA. Ferrara
et al.,
supra. White VEGF is a high-affinity ligand for Flt1 and Flk1, it does not bind or activate
Flt4. Pajusola
et al.,
Oncogene,
9,
supra. The only other closely related member of the VEGF family is placental growth factor
(PlGF), which has 47% amino acid identity with VEGF. Maglione
et al.,
Proc. Natl. Acad. Sci. USA,
88: 9267-9271(1991). PIGF also occurs in two alternatively spiked forms which differ
in the presence or absence of a basic heparin binding domain of 21 amino acids. Maglione
et al.,
Oncogene,
8: 925-931 (1993); Hauser and Weich,
Growth Factors,
9: 259-268 (1993). PIGF binds to Flt1 but not to Flk1 (Park
et al.,
J. Biol. Chem.,
269: 25646-25654 [1994]); it is believed that its binding to Flt4 has not been determined.
PIGF fails to duplicate the capillary endothelia cell mitogenesis or vascular permeability
activities of VEGF, suggesting that these activities are mediated by the Flk1 receptor.
Park
et al.,
supra.
[0007] Molecules that modulate the Flk1 receptor or neutralize activation of a VEGF receptor
are disclosed in the patent literature. For example, WO 95/21613 published 17 August
1995 discloses compounds that modulate KDR/Flk1 receptor signal transduction so as
to regulate and/or modulate vasculogenesis and angiogenesis and disclose using Flk1
to evaluate and screen for drugs and analogs of VEGF involved in Flk1 modulation by
either agonist or antagonist activities; WO 95/21865 published 17 August 1995 discloses
molecules immunointeractive with animal neuroepithelial kinase (NYK)/Flk1, which molecules
can be used to provide agents for treatment, prophylaxis, and diagnosis of an angiogenic-dependent
phenotype; and WO 95/21868 published 17 August 1995 discloses monoclonal antibodies
that specifically bind to an extracellular domain of a VEGF receptor and neutralize
activation of the receptor.
SUMMARY OF THE INVENTION
[0008] cDNA clones have now been identified that encode a novel protein, designated VRP,
which binds to and stimulates the phosphorylation of the receptor tyrosine kinase
Flt4. VRP is related in amino acid sequence to VEGF, but does not interact appreciably
with the VEGF receptors, Flt1 and Flk1.
[0009] In one aspect, the invention provides isolated biologically active human VRP containing
at least 265 amino acids of Figure 1. Preferably the isolated biologically active
human VEGF-related protein (VRP) comprises an amino acid sequence comprising at least
residues +1 through 29, inclusive, of Figure 1. In further aspect, the invention supplies
isolated biologically active human VRP comprising an amino acid sequence shown as
residues -20 through 399, inclusive, or residues 1 through 399, inclusive, of Figure
1.
[0010] The invention also pertains to chimeras comprising the VRP fused to another polypeptide.
For example, the invention provides a chimeric polypeptide comprising the VRP fused
to a tag polypeptide sequence. An example of such a chimera is epitope-tagged VRP.
[0011] In another aspect, the invention provides a composition comprising biologically active
VRP and a pharmaceutically acceptable carrier. In a more specific embodiment, the
invention provides a pharmaceutical composition useful for promotion of vascular or
lymph endothelial cell growth comprising a therapeutically effective amount of the
VRP in a pharmaceutically acceptable carrier. In another aspect, this composition
further comprises another cell growth factor such as VEGF and/or PDGF.
[0012] In a further aspect, the invention provides the use of the protein of the invention
in the manufacture of a medicament for treating trauma affecting the vascular endothelium
comprising administering to a mammal suffering from said trauma an effective amount
of the composition containing the VRP. The trauma is, for example, diabetic ulcers
or a wound of the blood vessels or heart In another embodiment, the invention provides
the use of the protein of the invention in the manufacture of a medicament for treating
a dysfunctional state characterized by lack of activation or lack of inhibition of
a receptor for VRP in a mammal comprising administering to the mammal an effective
amount of the composition containing the VRP.
[0013] The invention also provides an in vitro method which involves contacting the Flt4
receptor with the VRP to cause phosphorylation of the kinase domain thereof. For example,
the invention provides a method for stimulating the phosphorylation of a tyrosine
kinase domain of a Flt4 receptor comprising contacting an extracellular domain of
the Flt4 receptor with the VRP.
[0014] The invention also provides a monoclonal antibody which binds to the VRP and preferably
also neutralizes a biological activity of the protein, one biological activity being
characterized as promoting neovascularization or vascular permeability or vascular
endothelial cell growth in a mammal. Alternatively or conjunctively, the invention
provides a monoclonal antibody which binds to the N-terminal portion from residues
-20 through 137, inclusive, or from residues +1 through 137, inclusive, of the amino
acid sequence shown in Figure 1. The antibody can be used, for example, to detect
the presence of the VRP in a biological sample suspected of having the protein, or
to treat patients. The invention contemplates a pharmaceutical composition comprising
such antibody and a pharmaceutically acceptable carrier.
[0015] In addition, the invention contemplates a peptide consisting of an amino acid sequence
shown as residues -20 through -1, inclusive, of Figure 1.
[0016] In a further embodiment, the invention provides an isolated nucleic acid molecule
encoding VRP or a VRP chimera. In one aspect, the nucleic acid molecule is RNA or
DNA that encodes a biologically active VRP or is complementary to nucleic acid sequence
encoding such VRP, and remains stably bound to it under stringent conditions. The
nucleic acid molecule optionally includes the regions of the nucleic acid sequences
of Figure 1 which encode signal sequences. In one embodiment, the nucleic acid sequence
is selected from:
(a) the coding region of the nucleic acid sequence of Figure 1 that codes for the
preprotein from residue -20 to residue 399 or that codes for the mature protein from
residue 1 to residue 399 (i.e., nucleotides 372 through 1628, inclusive, or nucleotides
432 through 1628, inclusive, of the nucleic acid sequence shown in Figure 1 as SEQ
ID NO: 1); or
(b) a sequence corresponding to the sequence of(a) within the scope of degeneracy
of the genetic code.
[0017] In another aspect, the nucleic acid molecule can be provided in a replicable vector
comprising the nucleic acid molecule operably linked to control sequences recognized
by a host cell transfected or transformed with the vector. The invention further provides
a host cell comprising the vector or the nucleic acid molecule. A method of producing
VRP is also provided which comprises culturing a host cell comprising the nucleic
acid molecule and recovering the protein from the host cell culture.
BRIEF DESCRIPTION OF THE DRAWINGS
[0018]
Figures 1A-1D depict the nucleotide coding sequence (SEQ ID NO: 1), nucleotide complementary
sequence (SEQ ID NO: 2), and deduced amino acid sequence (SEQ ID NO: 3) of the human
VRP described herein.
Figure 2 depicts binding of Flt4/IgG and of Rse/IgG (an unrelated receptor fusion
protein) to the human glioma cell line G61, which binding was evaluated by FACS analysis.
Figures 3A and 3B respectively depict a map of cDNA clones encoding human VRP and
an alignment of the protein sequence VRP (SEQ ID NO: 3) with that of VEGF121 (SEQ ID NO: 4) and PIGF131 (SEQ ID NO: 5). Figure 3A shows the extent of four VRP cDNA clones; dashed lines
indicate the missing portions of VH1.1 and VH1.3. Arrows indicate restriction enzyme
sites; the shaded box indicates the putative secretion signal sequence; the open box
indicates the mature protein; Y-type designations within the open box indicate the
potential N-linked glycosylation sites; and vertical lines indicate the cysteine residues.
A diagram of VEGF121 is shown for comparison. The hydropathy plot (Kyle and Doolittle, J. Mol. Biol., 157: 105-132 [1982]) is for VRP. In Figure 3B, overlining indicates the region encoded
by an expressed sequence tag (EST) (sequence of a portion of a cDNA clone) from GenBank
designated HSC1WF111.
Figure 4 depicts a map of the cDNA clone for full-length human VRP herein versus eleven
known ESTs. The eleven EST partial amino acid sequence fragments are H07991 and H07899
(5' and 3' ends of the same cloned fragment, respectively), H05134 and H05177 (3'
and 5' ends of the same cloned fragment, respectively), HSC1WF112 and HSC1WF111 (3'
and 5' ends of the same cloned fragment, respectively), T81481 and T81690 (3' and
5' ends of the same cloned fragment, respectively), R77495 (a 3' end of a cloned fragment),
and T84377 and T89295 (5' and 3' ends of the same cloned fragment, respectively).
Figure 5 depicts binding of 125I-Flt4/IgG to purified VRP. The binding was performed in the absence (-) or presence
(+) of 100 nM receptor IgG fusion protein (Fig. 5A) or with increasing concentrations
of Flt4/IgG (Fig. 5B).
Figure 6 shows a graph of the cell count of human lung microvascular endothelial cells
as a function of the concentration of VEGF or VRP in the cell culture medium to assess
and compare mitogenic activity.
DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS
I. Definitions
[0019] In describing the present invention, the following terms will be employed, and are
intended to be defined as indicated below.
[0020] "Human VRP" is defined herein to be a polypeptide sequence containing at least residues
-20 to 399, inclusive, or residues +1 to 399, inclusive, of the amino acid sequence
shown in Figure 1, including residues -5 to 399, inclusive, and residues -4 to 399,
inclusive, of the amino acid sequence shown in Figure 1, as well as biologically active
deletional, insertional, or substitutional variants of the above sequences having
at least 265 amino acids and preferably, having at least residues +1 through 29, inclusive,
of Figure 1. In a preferred embodiment, the protein sequence has at least residues
+1 through 137, inclusive, of Figure 1, more preferably at least residues -20 through
29, inclusive, of Figure 1, and most preferably at least residues -20 through 137,
inclusive, of Figure 1. In another preferred embodiment, the biologically active variants
have a length of 265 to about 450 amino acid residues, more preferably about 300-450,
even more preferably about 350-450, and most preferably about 399-419 amino acid residues.
Another preferred set of variants are variants that are insertional or substitutional
variants, or deletional variants where the deletion is in the signal sequence and/or
is not in the N-terminal region of the molecule (
i.e., residues 1-29, preferably residues 1-137). The definition of VRP excludes all known
EST sequences, such as,
e.g., H07991, H05134, H05177, HSC1WF112, HSC1WF111, T81481, R77495, H07899, T84377, T81690,
and T89295, as well as all forms of VEGF and PIGF.
[0021] "Biologically active" for the purposes herein means having the ability to bind to,
and stimulate the phosphorylation of, the Flt4 receptor. Generally, the protein will
bind to the extracellular domain of the Flt4 receptor and thereby activate or inhibit
the intracellular tyrosine kinase domain thereof. Consequently, binding of the protein
to the receptor may result in enhancement or inhibition of proliferation and/or differentiation
and/or activation of cells having the Flt4 receptor for the VRP
in vivo or
in vitro. Binding of the protein to the Flt4 receptor can be determined using conventional
techniques, including competitive binding methods, such as RIAs, ELISAs, and other
competitive binding assays. Ligand/receptor complexes can be identified using such
separation methods as filtration, centrifugation, flow cytometry (see,
e.g., Lyman
et al., Cell,
75:1157-1167 [1993]; Urdal
et al.,
J. Biol, Chem., 263:2870-2877 [1988]; and Gearing
et al.,
EMBO J.,
8:3667-3676 [1989]), and the like. Results from binding studies can be analyzed using
any conventional graphical representation of the binding data, such as Scatchard analysis
(Scatchard,
Ann. NY Acad. Sci.,
51:660-672 [1949]; Goodwin
et al.,
Cell,
73:447-456 [1993]), and the like. Since the VRP induces phosphorylation of the Flt4
receptor, conventional tyrosine phosphorylation assays, such as the assay described
in Example 5 herein, can also be used as an indication of the formation of a Flt4
receptor/VRP complex.
[0022] The term "epitope tagged" when used herein refers to a chimeric polypeptide comprising
the entire VRP, or a portion thereof, fused to a "tag polypeptide". The tag potypcptide
has enough residues to provide an epitope against which an antibody thereagainst can
be made, yet is short enough such that it does not interfere with activity of the
VRP. The tag polypeptide preferably also is fairly unique so that the antibody thereagainst
does not substantially cross-react with other epitopes. Suitable tag polypeptides
generally have at least six amino acid residues and usually between about 8-50 amino
acid residues (preferably between about 9-30 residues).
[0023] "Isolated," when used to describe the various proteins disclosed herein, means protein
that has been identified and separated and/or recovered from a component of its natural
environment. Contaminant components of its natural environment are materials that
would interfere with diagnostic or therapeutic uses for the protein, and may include
enzymes, hormones, and other proteinaceous or non-proteinaceous solutes. In preferred
embodiments, the protein will be purified (1) to a degree sufficient to obtain at
least 15 residues of N-terminal or internal amino acid sequence by use of a spinning
cup sequenator, or (2) to homogeneity by SDS-PAGE under non-reducing or reducing conditions
using Coomassie blue or, preferably, silver stain. Isolated protein includes protein
in situ within recombinant cells, since at least one component of the VRP natural environment
will not be present. Ordinarily, however, isolated protein will be prepared by at
least one purification step.
[0024] "Essentially pure" protein means a composition comprising at least about 90% by weight
of the protein, based on total weight of the composition, preferably at least about
95% by weight "Essentially homogeneous" protein means a composition comprising at
least about 99% by weight of protein, based on total weight of the composition.
[0025] An "isolated" VRP nucleic acid molecule is a nucleic acid molecule that is identified
and separated from at least one contaminant nucleic acid molecule with which it is
ordinarily associated in the natural source of the VRP nucleic acid. An isolated VRP
nucleic acid molecule is other than in the form or setting in which it is found in
nature. Isolated VRP nucleic acid molecules therefore are distinguished from the VRP
nucleic acid molecule as it exists in natural cells. However, an isolated VRP nucleic
acid molecule includes VRP nucleic acid molecules contained in cells that ordinarily
express VRP where, for example, the nucleic acid molecule is in a chromosomal location
different from that of natural cells.
[0026] The isolated VRP polypeptide, VRP nucleic acid, or VRP antibody may be labeled for
diagnostic and probe purposes, using a label as described and defined further below
in the discussion on uses of VRP antibodies.
[0027] The expression "control sequences" refers to DNA sequences necessary for the expression
of an operably linked coding sequence in a particular host organism. The control sequences
that are suitable for prokaryotes, for example, include a promoter, optionally an
operator sequence, a ribosome binding site, and possibly, other as yet poorly understood
sequences. Eukaryotic cells are known to utilize promoters, polyadenylation signals,
and enhancers.
[0028] Nucleic acid is "operably linked' when it is placed into a functional relationship
with another nucleic acid sequence. For example, DNA for a presequence or secretory
leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein
that participates in the secretion of the polypeptide; a promoter or enhancer is operably
linked to a coding sequence if it affects the transcription of the sequence: or a
ribosome binding site is operably linked to a coding sequence if it is positioned
so as to facilitate translation. Generally, "operably linked" means that the DNA sequences
being linked are contiguous, and, in the case of a secretory leader, contiguous and
in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished
by ligation at convenient restriction sites. If such sites do not exist, the synthetic
oligonucleotide adaptors or linkers are used in accordance with conventional practice.
[0029] The term "antibody" is used in the broadest sense and specifically covers single
anti-VRP monoclonal antibodies (including agonist and antagonist antibodies) and anti-VRP
antibody compositions with polyepitopic specificity.
[0030] The term "monoclonal antibody" as used herein refers to an antibody obtained from
a population of substantially homogeneous antibodies,
i.e., the individual antibodies comprising the population are identical except for possible
naturally-occurring mutations that may be present in minor amounts. Monoclonal antibodies
are highly specific, being directed against a single antigenic site. Furthermore,
in contrast so conventional (polyclonal) antibody preparations which typically include
different antibodies directed against different determinants (epitopes), each monoclonal
antibody is directed against a single determinant on the antigen.
[0031] The monoclonal antibodies herein include hybrid and recombinant antibodies produced
by splicing a variable (including hypervariable) domain of an anti-VRP antibody with
a constant domain (
e.g. "humanized" antibodies), or a light chain with a heavy chain, or a chain from one
species with a chain from another species, or fusions with heterologous proteins,
regardless of species of origin or immunoglobulin class or subclass designation, as
well as antibody fragments (
e.g., Fab. F(ab')
2. and Fv), so long as they exhibit the desired biological activity. See,
e.g. U.S. Pat. No. 4,816,567 and Mage and Lamoyi, in
Monoclonal Antibody Production Techniques and Applications, pp.79-97 (Marcel Dekker, Inc.: New York, 1987).
[0032] Thus, the modifier "monoclonal" indicates the character of the antibody as being
obtained from a substantially homogeneous population of antibodies, and is not to
be construed as requiring production of the antibody by any particular method. For
example, the monoclonal antibodies to be used in accordance with the present invention
may be made by the hybridoma method first described by Kohler and Milstein,
Nature, 256:495 (1975), or may be made by recombinant DNA methods. U.S. Pat. No. 4,816,567. The
"monoclonal antibodies" may also be isolated from phage libraries generated using
the techniques described in McCafferty
et al.,
Nature,
348:552-554 (1990), for example.
[0033] "Humanized" forms of non-human (
e.g. murine) antibodies are specific chimeric immunoglobulins, immunoglobulin chains,
or fragments thereof (such as Fv, Fab, Fab', F(ab')
2 or other antigen-binding subsequences of antibodies) which contain minimal sequence
derived from non-human immunoglobulin. For the most part, humanized antibodies are
human immunoglobulins (recipient antibody) in which residues from a complementary
determining region (CDR) of the recipient are replaced by residues from a CDR of a
non-human species (donor antibody) such as mouse, rat. or rabbit having the desired
specificity, affinity, and capacity. In some instances, Fv framework region (FR) residues
of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore,
the humanized antibody may comprise residues which are found neither in the recipient
antibody nor in the imported CDR or framework sequences. These modifications are made
to further refine and optimize antibody performance. In general. the humanized antibody
will comprise substantially all of at least one. and typically two. variable domains,
in which all or substantially all of the CDR regions correspond to those of a non-human
immunoglobulin and all or substantially all of the FR regions are those of a human
immunoglobulin consensus sequence. The humanized antibody optimally also will comprise
at least a portion of an immunoglobulin constant region (Fc), typically that of a
human immunoglobulin.
[0034] As used herein, "vascular endothelial cell growth factor," or "VEGF," refers to a
mammalian growth factor derived originally from bovine pituitary follicular cells
having the amino acid sequence of Fig. 2 of WO 90/13649, and has the human amino acid
sequence of Fig. 10 of WO 90/13649. See also U.S. Pat. No. 5,194,596, which discloses
bovine VEGF of 120 amino acids and human VEGF of 121 amino acids. The biological activity
of native VEGF is capable of promoting selective growth of vascular endothelial cells
but not of bovine corneal endothelial cells, lens epithelial cells, adrenal cortex
cells, BHK-21 fibroblasts, or keratinocytes.
[0035] The expression "trauma affecting the vascular endothelium" refers to trauma, such
as injuries, to the blood vessels or heart, including the vascular network of organs,
to which an animal or human, preferably a mammal, and most preferably a human, is
subjected. Examples of such trauma include wounds, incisions, and ulcers, most preferably
diabetic ulcers and wounds or lacerations of the blood vessels or heart. Trauma includes
conditions caused by internal events as well as those that are imposed by an extrinsic
agent such as a pathogen, which can be improved by promotion of vascular endothelial
cell growth. It also refers to the treatment of wounds in which neovascularization
or re-endothelialization is required for healing.
[0036] "Promotion of vascular or lymph endothelial cell growth" refers to inducing or increasing
the growth of vascular or lymph endothelial cells, including human lung microvascular
endothelial cells.
[0037] ''Disorders related to vasculogenesis and angiogenesis" include cancer, diabetes,
hemangioma, and Kaposi's sarcoma.
[0038] "Diseases or disorders characterized by undesirable excessive neovascularization
or vascular permeability" refer to diseases or disorders that include, by way of example,
excessive neovascularization. tumors, and especially solid malignant tumors, rheumatoid
arthritis, psoriasis, atherosclerosis, diabetic and other retinopathies. retrolental
fibroplasia, age-related macular degeneration, neovascular glaucoma, hemangiomas.
thyroid hyperplasias (including Grave's disease), corneal and other tissue transplantation,
and chronic inflammation. Examples of diseases or disorders characterized by undesirable
excessive vascular permeability include edema associated with brain tumors, ascites
associated with malignancies. Meigs' syndrome, lung inflammation, nephrotic syndrome,
pericardial effusion (such as that associated with pericarditis), and pleural effusion.
[0039] "Dysfunctional states characterized by excessive activation or inhibition of a receptor
for VRP" (such receptor including Flt4) refer to disorders or diseases that would
be beneficially treated by providing to a mammal having such a pathological condition
an antagonist to VRP, such as a chimera of Flt4 or its extracellular domain (
e.g., an IgG fusion with Flt4) or an antibody to VRP.
[0040] "Dysfunctional states characterized by lack of activation or lack of inhibition of
a receptor for VRP" (such receptor including Flt4) refer to disorders or diseases
that would be beneficially treated by providing VRP or a VRP receptor agonist to a
mammal with such a pathological condition.
[0041] "Treatment" refers to both therapeutic treatment and prophylactic or preventative
measures. Those in need of treatment include those already with the disorder as well
as those prone to have the disorder or those in which the disorder is to be prevented.
[0042] "Mammal" for purposes of treatment refers to any animal classified as a mammal, including
humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs,
horses, cats, cows,
etc. Preferably, the mammal herein is human.
[0043] "Effective amount" or "therapeutically effective amount" of the VRP, VRP composition,
antibody, or antibody composition is an amount that is effective either to prevent,
lessen the worsening of, alleviate, or cure the treated condition. For example, an
effective amount of VRP includes that amount which is sufficient to enhance the growth
of vascular endothelium
in vivo or to treat trauma, and an "effective amount" of VRP antibody includes that amount
which is sufficient to reduce excess neovascularization and angiogenesis.
II. Modes for Carrying Out the Invention
[0044] The present invention is based on the discovery of a novel VRP which binds to, and
stimulates the phosphorylation of, the Flt4 receptor.
[0045] Three approaches were undertaken to identify protein diat would bind and stimulate
the phosphorylation of the Flt4 receptor. First, the full-length receptor was stably
expressed in 293 cells to establish a receptor tyrosine kinase phosphorylation assay
of Flt4 activation. This assay was used to screen about 400 cell supematants and tissue
extracts, without positive results.
[0046] Second, the extracellular domain of the receptor was expressed as a fusion protein
with an immunoglobulin Fc domain. By using this fusion protein (Flt4/IgG) to screen
cell lines for membrane-bound ligands by FACS analysis, one positive cell line was
identified. The human glioma line, G61, gave about a 10-fold shift in peak fluorescence
intensity that was specific for Flt4/IgG (Fig. 2). Attempts to expression clone this
putative membrane-bound ligand by the transfection of pools of cDNA clones into COS
cells followed by screening with labeled Fh4/IgG gave no positives from 640 pools
of 1000-5000 clones each. Flt4/IgG was also used to generate polyclonal antisera and
monoclonal antibodies that had agonistic activity and that were used to develop the
Flt4 tyrosine phosphorylation assay as described in Example 5 below.
[0047] Third, candidate ligand proteins were tested for their ability to bind to Flt4/IgG
or to activate the Flt4 phosphorylation assay. Labeled VEGF failed to bind to Flt4/IgG,
although the expected binding of VEGF to Flt1/IgG or Flk1/IgG was routinely detected.
The failure of VEGF to bind or stimulate the phosphorylation of Flt4 has been reported
by Pajusola
et al.,
Oncogene,
9,
supra. An additional candidate ligand protein was found by use of cloning techniques, details
of which are provided in Example 3 below. The human VRP cDNA sequence is depicted
In Figure 1A-1D. The predicted molecular weight of the protein is 44.8 kDa,
[0048] A description follows as to how the biologically active human VRP may be prepared.
1. Preparation of VRP
[0049] Most of the discussion below pertains to production of VRP by culturing cells transformed
with a vector containing VRP nucleic acid and recovering the polypeptide from the
cell culture. It is further envisioned that the VRP of this invention may be produced
by homologous recombination, as provided for in WO 91/06667. published 16 May 1991.
[0050] Briefly, this method involves transforming primary human cells containing a human
VRP-encoding gene with a construct (
i.
e., vector) comprising an amplifiable gene [such as dihydrofolate reductase (DHFR)
or others discussed below] and at least one flanking region of a length of at least
about 150 bp that is homologous with a DNA sequence at the locus of the coding region
of the VRP gene to provide amplification of the VRP gene. The amplifiable gene must
be at a site that does not interfere with expression of the VRP gene. The transformation
is conducted such that the construct becomes homologously integrated into the genome
of the primary cells to define an amplifiable region.
[0051] Primary cells comprising the construct are then selected for by means of the ampliflable
gene or other marker present in the construct. The presence of the marker gene establishes
the presence and integration of the construct into the host genome. No further selection
of the primary cells need be made, since selection will be made in the second host.
If desired, the occurrence of the homologous recombination event can be determined
by employing PCR and either sequencing the resulting amplified DNA sequences or determining
the appropriate length of the PCR fragment when DNA from correct homologous integrants
is present and expanding only those cells containing such fragments. Also if desired,
the selected cells may be amplified at this point by stressing the cells with the
appropriate amplifying agent (such as methotrexate if the amplifiable gene is DHFR),
so that multiple copies of die target gene are obtained. Preferably, however, the
amplification step is not conducted until after the second transformation described
below.
[0052] After the selection step, DNA portions of the genome, sufficiently large to include
the entire amplifiable region, are isolated from the selected primary cells. Secondary
mammalian expression host cells are then transformed with these genomic DNA portions
and cloned, and clones are selected that contain the amplifiable region. The amplifiable
region is then amplified by means of an amplifying agent if not already amplified
in the primary cells. Finally, the secondary expression host cells now comprising
multiple copies of the amplifiable region containing VRP are grown so as to express
the gene and produce the protein.
A. Isolation of DNA Encoding VRP
[0053] The DNA encoding VRP may be obtained from any cDNA library prepared from tissue believed
to possess the VRP mRNA and to express it at a detectable level. Accordingly, human
VRP DNA can be conveniently obtained from a cDNA library prepared from human brain
tissue, e.g., a glial cell line. The VRP-encoding gene may also be obtained from a
genomic library or by oligonucleotide synthesis.
[0054] Libraries are screened with probes (such as antibodies to the VRP or oligonucleotides
of about 20-80 bases) designed to identify the gene of interest or the protein encoded
by it. Screening the cDNA or genomic library with the selected probe may be conducted
using standard procedures as described in chapters 10-12 of Sambrook
et al.,
Molecular Cloning: A Laboratory Manual (New York: Cold Spring Harbor Laboratory Press, 1989). An alternative means to isolate
the gene encoding VRP is to use PCR methodology as described in section 14 of Sambrook
et al.,
supra.
[0055] A preferred method of practicing this invention is to use carefully selected oligonucleotide
sequences to screen cDNA libraries from various human tissues, preferably brain cell
lines. The oligonucleotide sequences selected as probes should be of sufficient length
and sufficiently unambiguous that false positives are minimized.
[0056] The oligonucleotide must be labeled such that it can be detected upon hybridization
to DNA in the library being screened. The preferred method of labeling is to use
32P-labeled ATP with polynucleotide kinase, as is well known in the art. to radiolabel
the oligonucleotide. However, other methods may be used to label the oligonucleotide,
including, but not limited to, biotinylation or enzyme labeling.
[0057] In some preferred embodiments, the nucleic acid sequence includes the native VRP
signal sequence. Nucleic acid having all the protein coding sequence is obtained by
screening selected cDNA orgenomic libraries using the deduced amino acid sequence
disclosed herein for the first time, and, if necessary, using conventional primer
extension procedures as described in section 7.79 of Sambrook
et al., supra, to detect precursors and processing intermediates of mRNA that may not have been
reverse-transcribed into cDNA.
[0058] Amino acid sequence variants of VRP are prepared by introducing appropriate nucleotide
changes into the VRP DNA, or by synthesis of the desired VRP polypeptide. Such variants
represent insertions, substitutions, and/or deletions of, residues within or at one
or both of the ends of the amino acid sequence shown for the VRP in Figure 1. Preferably,
these variants represent insertions and/or substitutions within or at one or both
ends of the mature sequence, and/or insertions, substitutions and/or deletions within
or at one or both of the ends of the signal sequence for VRP shown in Fig. 1. Any
combination of insertion, substitution, and/or deletion is made to arrive at the final
construct, provided that the final construct possesses the desired biological activity
as defined herein. The amino acid changes also may alter post-translational processes
of the VRP. such as changing the number or position of glycosylation sites, altering
the membrane anchoring characteristics, and/or altering the intracellular location
of the VRP by inserting, deleting, or otherwise affecting the leader sequence of the
VRP.
[0059] Variations in the native sequence as described above can be made using any of the
techniques and guidelines for conservative and non-conservative mutations set forth
in U.S. Pat. No. 5,364,934. These include oligonucleotide-mediated (site-directed)
mutagenesis, alanine scanning, and PCR mutagenesis. See also, for example, Table I
therein and the discussion surrounding this table for guidance on selecting amino
acids to change, add, or delete.
B. Insertion of Nucleic Acid into Replicable Vector
[0060] The nucleic acid (
e.g., cDNA or genomic DNA) encoding native or variant VRP is inserted into a replicable
vector for further cloning (amplification of the DNA) or for expression. Many vectors
are available. The vector components generally include, but are not limited to, one
or more of the following: a signal sequence, an origin of replication, one or more
marker genes, an enhancer element, a promoter, and a transcription termination sequence.
(i) Signal Sequence Component
[0061] The VRPs of this invention may be produced recombinantly not only directly, but also
as a fusion polypeptide with a heterologous polypeptide, which is preferably a signal
sequence or other polypeptide having a specific cleavage site at the N-terminus of
the mature protein or polypeptide. In general, the signal sequence may be a component
of the vector, or it may be a part of the VRP DNA that is inserted into the vector.
The heterologous signal sequence selected preferably is one that is recognized and
processed (
i.e., cleaved by a signal peptidase) by the host cell. For prokaryotic host cells that
do not recognize and process the native VRP signal sequence, the signal sequence is
substituted by a prokaryotic signal sequence selected, for example, from the group
of the alkaline phosphatase, penicillinase, Ipp, or heat-stable enterotoxin II leaders.
For yeast secretion the native signal sequence may be substituted by,
e.g., the yeast invertase leader, alpha factor leader (including
Saccharomyces and
Kluyveromyces α-factor leaders, the latter described in U.S. Pat. No. 5,010,182 issued 23 April
1991), or acid phosphatase leader, the
C. albicans glucoamylase leader (EP 362,179 published 4 April 1990), or the signal described
in WO 90/13646 published 15 November 1990. In mammalian cell expression the native
signal sequence (
e.g., the VRP presequence that normally directs secretion of VRP from human cells
in vivo) is satisfactory, although other mammalian signal sequences may be suitable, such
as signal sequences from other animal VRPs. and signal sequences from secreted polypeptides
of the same or related species. as well as viral secretory leaders, for example, the
herpes simplex gD signal.
[0062] The DNA for such precursor region is ligated in reading frame to DNA encoding the
mature VRP.
(ii) Origin of Replication Component
[0063] Both expression and cloning vectors contain a nucleic acid sequence that enables
the vector to replicate in one or more selected host cells. Generally, in cloning
vectors this sequence is one that enables the vector to replicate independently of
the host chromosomal DNA, and includes origins of replication or autonomously replicating
sequences. Such sequences are well known for a variety of bacteria, yeast, and viruses.
The origin of replication from the plasmid pBR322 is suitable for most Grain-negative
bacteria, the 2µ plasmid origin is suitable for yeast, and various viral origins (SV40,
polyoma, adenovirus, VSV or BPV) are useful for cloning vectors in mammalian cells.
Generally, the origin of replication component is not needed for mammalian expression
vectors (the SV40 origin may typically be used only because it contains the early
promoter).
[0064] Most expression vectors are "shuttle" vectors,
i.e., they are capable of replication in at least one class of organisms but can be transfected
into another organism for expression. For example, a vector is cloned in
E. coli and then the same vector is transfected into yeast or mammalian cells for expression
even though it is not capable of replicating independently of the host cell chromosome.
[0065] DNA may also be amplified by insertion into the host genome. This is readily accomplished
using
Bacillus species as hosts, for example, by including in the vector a DNA sequence that is
complementary to a sequence found in
Bacillus genomic DNA. Transection of
Bacillus with this vector results in homologous recombination with the genome and insertion
of VRP DNA. However, the recovery of genomic DNA encoding VRP is more complex than
that of an exogenously replicated vector because restriction enzyme digestion is required
to excise the VRP DNA.
(iii) Selection Gene Component
[0066] Expression and cloning vectors should contain a selection gene, also termed a selectable
marker. This gene encodes a protein necessary for the survival or growth of transformed
host cells grown in a selective culture medium. Host cells not transformed with the
vector containing the selection gene will not survive in the culture medium. Typical
selection genes encode proteins that (a) confer resistance to antibiotics or other
toxins,
e.g., ampicillin, neomycin, methotrexate, or tetracycline, (b) complement auxotrophic
deficiencies, or (c) supply critical nutrients not available from complex media,
e.g., the gene encoding D-alanine recemase for
Bacilli.
[0067] One example of a selection scheme utilizes a drug to arrest growth of a host cell.
Those cells that are successfully transformed with a heterologous gene produce a protein
conferring drug resistance and thus survive the selection regimen. Examples of such
dominant selection use the drugs neomycin (Southern
et al.,
J. Molec. Appl. Genet.,
1:327 [1982]), mycophenolic acid (Mulligan
et al.,
Science,
209:1422 [1980]) or hygromycin. Sugden
et al.,
Mol. Cell. Biol., 5:410-413 (1985). The three examples given above employ bacterial genes under eukaryotic
control to convey resistance to the appropriate drug G418 or neomycin (geneocin),
xgpt (mycophenolic acid), or hygromycin, respectively.
[0068] Another example of suitable selectable markers for mammalian cells are those that
enable the identification of cells competent to take up the VRP nucleic acid. such
as DHFR or thymidine kinase. The mammalian cell transformants are placed under selection
pressure that only the transformants are uniquely adapted to survive by virtue of
having taken up the marker. Selection pressure is imposed by culturing the transformants
under conditions in which the concentration of selection agent in the medium is successively
changed, thereby leading to amplification of both the selection gene and the DNA that
encodes VRP. Amplification is me process by which genes in greater demard for the
production of a protein critical for growth are reiterated in tandem within the chromosomes
of successive generations of recombinant cells. Increased quantities of VRP are synthesized
from the amplified DNA. Other examples of amplifiable genes include metallothionein-I
and -II, preferably primate metallothionein genes, adenosine deaminase, omithine decarboxylase,
etc.
[0069] For example, cells transformed with the DHFR selection gene are first identified
by culturing all of the transformants in a culture medium that contains methotrexate
(Mtx), a competitive antagonist of DHFR. An appropriate host cell when wild-type DHFR
is employed is the Chinese hamster ovary (CHO) cell line deficient in DHFR activity,
prepared and propagated as described by Urlaub and Chasin,
Proc. Natl. Acad. Sci. USA,
77:4216(1980). The transformed cells are then exposed to increased levels of methotrexate.
This leads to the synthesis of multiple copies of the DHFR gene, and, concomitantly,
multiple copies of other DNA comprising the expression vectors, such as the DNA encoding
VRP. This amplification technique can be used with any otherwise suitable host,
e.g., ATCC No. CCL61 CHO-K1. notwithstanding the presence of endogenous DHFR if, for
example, a mutant DHFR gene that is highly resistant to Mtx is employed (EP 117,060).
[0070] Alternatively, host cells [particularly wild-type hosts that contain endogenous DHFR]
transformed or co-transformed with DNA sequences encoding VRP, wild-type DHFR protein,
and another selectable marker such as aminoglycoside 3'-phosphotransferase (APH) can
be selected by cell growth in medium containing a selection agent for the selectable
marker such as an aminoglycosidic antibiotic,
e.g., kanamycin, neomycin, or G418. See U.S. Patent No. 4,965,199.
[0071] A suitable selection gene for use in yeast is the
trp1 gene present in the yeast plasmid YRp7. Stinchcomb
et al.,
Nature,
282:39 (1979); Kingsman
et al.,
Gene,
7:141 (1979); Tschemper
et al.,
Gene,
10:157 (1980). The
trp1 gene provides a selection marker for a mutant strain of yeast lacking the ability
to grow in tryptophan, for example, ATCC No. 44076 or PEP4-1. Jones,
Genetics,
85:12 (1977). The presence of the
trp1 lesion in the yeast host cell genome then provides an effective environment for
detecting transformation by growth in the absence of tryptophan. Similarly,
Leu2-deficient yeast strains (ATCC 20,622 or 38,626) are complemented by known plasmids
bearing the
Leu2 gene.
[0072] In addition, vectors daivcd from the 1.6 µm circular plasmid pKD1 can be used for
transformation of
Kluyveromyces yeasts. Bianchi
et al.,
Curr. Genet.,
12:185 (1987). More recently, an expression system for large-scale production of recombinant
calf chymosin was reported for
K.
lactis. Van den Berg,
Bio/Technology,
8:135 (1990). Stable multi-copy expression vectors for secretion of mature recombinant
human serum albumin by industrial strains of
Kluyveromyces have also been disclosed. Fleer
et al.,
Bio/Technology,
9:968-975 (1991).
(iv) Promoter Component
[0073] Expression and cloning vectors usually contain a promoter that is recognized by the
host organism and is operably linked to the VRP nucleic acid. Promoters are untranslated
sequences located upstream (5') to the start codon of a structural gene (generally
within about 100 to 1000 bp) that control the transcription and translation of particular
nucleic acid sequence, such as the VRP nucleic acid sequence, to which they are operably
linked. Such promoters typically fall into two classes, inducible and constitutive.
Inducible promoters are promoters that initiate increased levels of transcription
from DNA under their control in response to some change in culture conditions.
e.g., the presence or absence of a nutrient or a change in temperature. At this time a
large number of promoters recognized by a variety of potential host cells are well
known. These promoters are operably linked to VRP-encoding DNA by removing the promoter
from the source DNA by restriction enzyme digestion and inserting the isolated promoter
sequence into the vector. Both the native VRP promoter sequence and many heterologous
promoters may be used to direct amplification and/or expression of the VRP DNA. However,
heterologous promoters are preferred, as they generally permit greater transcription
and higher yields of VRP as compared to the native VRP promoter.
[0074] Promoters suitable for use with prokaryotic hosts include the β-lactamase and lactose
promoter systems (Chang
et al.,
Nature,
275:615 [1978]; Goeddel
et al.,
Nature,
281:544 [1979]), alkaline phosphatase, a tryptophan (trp) promoter system (Goeddel,
Nucleic Acids Res.,
8:4057 [1980]; EP 36,776), and hybrid promoters such as the tac promoter. deBoer
et al.,
Proc. Natl. Acad. Sci. USA,
80:21-25(1983). However, other known bacterial promoters are suitable. Their nucteotide
sequences have been published, thereby enabling a skilled worker operably to ligate
them to DNA encoding VRP (Siebenlist
et al.,
Cell 20:269 [1980]) using linkers or adaptors to supply any required restriction sites. Promoters
for use in bacterial systems also will contain a Shine-Dalgarno (S.D.) sequence operably
linked to the DNA encoding VRP.
[0075] Promoter sequences are known for eukaryotes. Virtually all eukaryodc genes have an
AT-rich region located approximately 25 to 30 bases upstream from the site where transcription
is initiated. Another sequence found 70 to 80 bases upstream from the start of transcription
of many genes is a CXCAAT region where X may be any nucleotide. At the 3' end of most
eukaryotic genes is an AATAAA sequence that may be the signal for addition of the
poly A tail to the 3' end of the coding sequence. All of these sequences are suitably
inserted into eukaryotic expression vectors.
[0076] Examples of suitable promoting sequences for use with yeast hosts include the promoters
for 3-phosphoglycerate kinase (Hitzeman
et al.,
J. Biol. Chem.,
255:2073 [1980]) or other glycolytic enzymes (Hess
et al.,
J. Adv. Enzyme Reg., 7:149 [1968]; Holland,
Biochemistry, 17:4900 (1978]), such as enolase, glyceraldehyde-3-phosphate dehydrogenase, hexokinase,
pyruvate decarboxylase, phosphofructokinase, glucose-6-phosphate isomerase, 3-phosphoglycerate
mutase, pyruvate kinase, triosephosphate isomerase, phosphoglucose isomerase, and
glucokinase.
[0077] Other yeast promoters, which are inducible promoters having the additional advantage
of transcription controlled by growth conditions, are the promoter regions for alcohol
dehydrogenase 2, isocytochrome C, acid phosphatase, degradative enzymes associated
with nitrogen metabolism, metallothionein, glyceraldehyde-3-phosphate dehydrogenase,
and enzymes responsible for maltose and galactose utilization. Suitable vectors and
promoters for use in yeast expression are further described in EP 73,657. Yeast enhancers
also are advantageously used with yeast promoters.
[0078] VRP transcription from vectors in mammalian host cells is controlled, for example,
by promoters obtained from the genomes of viruses such as polyoma virus, fowlpox virus
(UK 2,211,504 published 5 July 1989), adenovirus (such as Adenovirus 2), bovine papilloma
virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus and most
preferably Simian Virus 40 (SV40), from heterologous mammalian promoters,
e.g., the actin promoter or an immunoglobulin promoter. from heat-shock promoters, and
from the promoter normally associated with the VRP sequence, provided such promoters
are compatible with the host cell systems.
[0079] The early and late promoters of the SV40 virus are conveniently obtained as an SV40
restriction fragment that also contains the SV40 viral origin of replication. Fiers
et al.,
Nature. 273:113 (1978); Mulligan and Berg,
Science, 209:1422-1427 (1980); Pavlakis
et al.,
Proc. Natl. Acad. Sci. USA, 78:7398-7402 (1981). The immediate early promoter of the human cytomegalovirus is conveniently
obtained as a
HindIII E restriction fragment. Greenaway
et al.,
Gene. 18:355-360 (1982). A system for expressing DNA in mammalian hosts using the bovine papilloma
virus as a vector is disclosed in U.S. Patent No. 4,419,446. A modification of this
system is described in U.S. Patent No. 4,601,978. See also Gray
et al.,
Nature, 295:503-508 (1982) on expressing cDNA encoding immune interferon in monkey cells; Reyes
et al.,
Nature, 297:598-601 (1982) on expression of human β-interferon cDNA in mouse cells under the
control of a thymidine kinase promoter from herpes simplex virus; Canaani and Berg,
Proc. Natl. Acad. Sci. USA 79:5166-5170 (1982) on expression of the human interferon β1 gene in cultured mouse
and rabbit cells; and German
et al.,
Proc. Natl. Acad. Sci. USA. 79:6777-6781 (1982) on expression of bacterial CAT sequences in CV-1 monkey kidney cells,
chicken embryo fibroblasts, Chinese hamster ovary cells, HeLa cells, and mouse NIH-3T3
cells using the Rous sarcoma virus long terminal repeat as a promoter.
(v) Enhancer Element Component
[0080] Transcription of a DNA encoding the VRP of this invention by higher eukaryotes is
often increased by inserting an enhancer sequence into the vector. Enhancers are cis-acting
elements of DNA, usually about from 10 to 300 bp, that act on a promoter to increase
its transcription. Enhancers are relatively orientation and position independent,
having been found 5' (Laimins
et al., Proc. Natl. Acad. Sci. USA,
78:993 [1981]) and 3' (Lusky
et al.,
Mol. Cell Bio.,
3:1108 [1983]) to the transcription unit, within an intron (Banerji
et al., Cell,
33:729 [1983]), as well as within the coding sequence itself. Osborne
et al., Mol. Cell Bio.,
4:1293 (1984). Many enhancer sequences are now known from mammalian genes (globin,
elastase, albumin, α-fetoprotein, and insulin). Typically, however, one will use an
enhancer from a eukaryotic cell virus. Examples include the SV40 enhancer on the late
side of the replication origin (bp 100-270), the cytomegalovirus early promoter enhancer,
the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers.
See also Yaniv,
Nature,
297:17-18 (1982) on enhancing elements for activation of eukaryotic promoters. The enhancer
may be spliced into the vector at a position 5' or 3' to the VRP-encoding sequence,
but is preferably located at a site 5' from the promoter.
(vi) Transcription Termination Component
[0081] Expression vectors used in eukaryotic host cells (yeast, fungi, insect, plant, animal,
human, or nucleated cells from other multicellular organisms) will also contain sequences
necessary for the termination of transcription and for stabilizing the mRNA. Such
sequences are commonly available from the 5' and, occasionally 3', untranslated regions
of eukaryotic or viral DNAs or cDNAs. These regions contain nucleotide segments transcribed
as polyadenylated fragments in the untranslated portion of the mRNA encoding VRP.
(vii) Construction and Analysis of Vectors
[0082] Construction of suitable vectors containing one or more of the above-listed components
employs standard ligation techniques. Isolated plasmids or DNA fragments are cleaved,
tailored, and re-ligated in the form desired to generate the plasmids required.
[0083] For analysis to confirm correct sequences in plasmids constructed, the ligation mixtures
are used to transform
E. coli K12 strain 294 (ATCC 31,446) and successful tramforreants selected by ampicillin
or tetracycline resistance where appropriate. Plasmids from the transformants are
prepared, analyzed by restriction endonuclease digestion, and/or sequenced by the
method of Messing
et al.,
Nucleic Acids Res.,
9:309 (1981) or by the method of Maxam
et al.,
Methods in Enzymology,
65:499 (1980).
(viii) Transient Expression Vectors
[0084] Particularly useful in the practice of this invention are expression vectors that
provide for the transient expression in mammalian cells of DNA encoding VRP. In general,
transient expression involves the use of an expression vector that is able to replicate
efficiently in a host cell, such that the host cell accumulates many copies of the
expression vector and, in turn, synthesizes high levels of a desired polypeptide encoded
by the expression vector. Sambrook
et al., supra, pp. 16.17 - 16.22. Transient expression systems, comprising a suitable expression
vector and a host cell, allow for the convenient positive identification of polypeptides
encoded by cloned DNAs, as well as for the rapid screening of such polypeptides for
desired biological or physiological properties. Thus, transient expression systems
are particularly useful in the invention for purposes of identifying analogs and variants
of VRP that are biologically active VRP.
(ix) Suitable Exemplary Vertebrate Cell Vectors
[0085] Other methods, vectors, and host cells suitable for adaptation to the synthesis of
VRP in recombinant vertebrate cell culture are described in Gething
et al.,
Nature,
293:620-625 (1981); Mantei
et al.,
Nature,
281:40-46 (1979); EP 117,060; and EP 117,058. A particularly useful plasmid for mammalian
cell culture expression of VRP is pRK5 (EP 307,247) or pSV16B. WO 91/08291 published
13 June 1991.
C. Selection and Transformation of Host Cells
[0086] Suitable host cells for cloning or expressing the DNA in the vectors herein are the
prokaryote, yeast. or higher eukaryote cells described above. Suitable prokaryotes
for this purpose include eubacteria, such as Gram-negative or Gram-positive organisms,
for example, Enterobacteriaceae such as
Escherichia, e.g., E. coli, Enterobacter. Erwinia, Klebsiella, Proteus, Salmonella,
e.g., Salmonella typhimurium, Serratia, e.g., Serratia marcescans, and
Shigella, as well as
Bacilli such as
B. subtilis and
B. licheniformis (
e.g., B. licheniformis 41P disclosed in DD 266,710 published 12 April 1989),
Pseudomonas such as
P. aeruginosa, and
Streptomyces. One preferred
E.
coil cloning host is
E. coli 294 (ATCC 31,446), although other strains such as
E. coli B,
E. coli X1776 (ATCC 31,537), and
E. coli W3110 (ATCC 27,325) are suitable. These examples are illustrative rather than limiting.
Strain W3110 is a particularly preferred host or parent host because it is a common
host strain for recombinant DNA product fermentations. Preferably, the host cell should
secrete minimal amounts of proteolytic enzymes. For example, strain W3110 may be modified
to effect a genetic mutation in the genes encoding proteins, with examples of such
hosts including
E. coli W3110 strain 27C7. The complete genotype of 27C7 is
tonA Δ ptr3 phoA ΔE15 Δ(argF-lac)169 ompT Δ degP41kanr. Strain 27C7 was deposited on 30 October 1991 in the American Type Culture Collection
as ATCC No. 55,244. Alternatively, the strain of
E. coli having mutant periplasmic protease disclosed in U.S. Patent No. 4.946.783 issued
7 August 1990 may be employed. Alternatively still, methods of cloning,
e.g., PCR or other nucleic acid polymerase reactions, are suitable.
[0087] In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast
are suitable cloning or expression hosts for VRP-encoding vectors.
Saccharomyces cerevisiae, or common baker's yeast, is the most commonly used among lower eukaryotic host microorganisms.
However, a number of other genera, species, and strains are commonly available and
useful herein, such as
Schizosaccharomyces pombe (Beach and Nurse,
Nature, 290:140 [1981]; EP 139,383 published 2 May 1985);
Kluyveromyces hosts (U.S. Patent No. 4,943,529; Fleer
et al., supra) such as,
e.g.,
K. lactis [MW98-8C, CBS683, CBS4574; Louvencourt
et al.,
J. Bacteriol., 737 (1983)],
K. fragilis (ATCC 12,424),
K. bulgaricus (ATCC 16,045),
K. wickeramii (ATCC 24,178),
K waltii (ATCC 56,500),
K. drosophilarum (ATCC 36,906; Van den Berg
et al.,
supra),
K. thermotolerans, and
K. marxianus: yarrowia [EP 402,226];
Pichia pastoris (EP 183,070; Sreekrishna
et al.,
J. Basic Microbiol., 28:265-278[1988]);
Candida; Trichoderma reesia (EP 244,234);
Neurospora crassa (Case
et al.,
Proc. Natl. Acad. Sci. USA, 76:5259-5263 [1979]);
Schwanniomyces such as
Schwanniomyces occidentalis (EP 394,538 published 31 October 1990); and filamentous fungi such as,
e.g.,
Neuraspora. Penicillium, Tolypocladium (WO 91/00357 published 10 January 1991), and
Aspergillus hosts such as
A. nidulans (Ballance
et al.,
Biochem, Biophys. Res. Commun., 112:284-289 [1983]; Tilburn
et al.,
Gene, 26:205-221 [1983]; Yelton
et al.,
Proc. Natl. Acad. Sci. USA.
81:1470-1474 [1984]) and
A. niger. Kelly and Hynes,
EMBO J., 4:475-479 (1985).
[0088] Suitable host cells for the expression of glycosylated VRP are derived from multicellular
organisms. Such host cells are capable of complex processing and glycosylation activities.
In principle, any higher eukaryotic cell culture is workable, whether from vertebrate
or invertebrate culture. Examples of invertebrate cells include plant and insect cells.
Numerous baculoviral strains and variants and corresponding permissive insect host
cells from hosts such as
Spodoptera frugiperda (caterpillar),
Aedes aegypti (mosquito),
Aedes albopictus (mosquito),
Drosophila melanoyaster (fruitfly), and
Bombyx mori have been identified. See,
e.g., Luckow
et al.,
Bio/Technology, 6:47-55 (1988); Miller
et al., in
Genetic Engineering, Setlow
et al., eds., Vol. 8 (Plenum Publishing, 1986), pp. 277-279; and Maeda
et al.,
Nature,
315:592-594 (1985). A variety of viral strains for transfection are publicly available,
e.g., the L-1 variant of
Autographa californica NPV and the Bm-5 strain of
Bombyx mori NPV, and such viruses may be used as the virus herein according to the present invention,
particularly for transfection of
Spodoptera frugiperda cells.
[0089] Plant cell cultures of cotton, com, potato, soybean, petunia, tomato, and tobacco
can be utilized as hosts. Typically, plant cells are transfected by incubation with
certain strains of the bacterium
Agrobacterium tumefaciens, which has been previously manipulated to contain the VRP-encoding DNA. During incubation
of the plant cell culture with
A. tumefaciens, the DNA encoding the VRP is transferred to the plant cell host such that it is transfected,
and will, under appropriate conditions, express the VRP-encoding DNA. In addition,
regulatory and signal sequences compatible with plant cells are available, such as
the nopaline synthase promoter and polyadenylation signal sequences. Depicker
et al.,
J. Mol. Appl. Gen., 1:561 (1982). In addition, DNA segments isolated from the upstream region of the T-DNA
780 gene are capable of activating or increasing transcription levels of plant-expressible
genes in recombinant DNA-containing plant tissue. EP 321,196 published 21 June 1989.
[0090] However, interest has been greatest in vertebrate cells, and propagation of vertebrate
cells in culture (tissue culture) has become a routine procedure. See.
e.g.,
Tissue Culture, Academic Press, Kruse and Patterson. editors (1973). Examples of useful mammalian
host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651);
human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture,
Graham
et al.,
J. Gen Virol.,
36:59 [1977]); baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary cells/-DHFR
(CHO, Urlaub and Chasin,
Proc. Natl. Acad. Sci. USA. 77:4216 [1980]); mouse sertoli cells (TM4, Mather,
Biol. Reprod.,
23:243-251 [1980]); monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney
cells (VERO-76, ATCC CRL-1587); human cervical carcinoma cells (HELA, ATCC CCL 2);
canine kidney cells (MDCK. ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL
1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065);
mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather
et al., Annals N.Y. Acad. Sci.,
383:44-68 [1982]); MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2).
[0091] Host cells are transfected and preferably transformed with the above-described expression
or cloning vectors for VRP production and cultured in conventional nutrient media
modified as appropriate for inducing promoters, selecting transformants, or amplifying
the genes encoding the desired sequences.
[0092] Transfection refers to the taking up of an expression vector by a host cell whether
or not any coding sequences are in fact expressed. Numerous methods of transfection
are known to the ordinarily skilled artisan, for example, CaPO
4 and electroporation. Successful transfection is generally recognized when any indication
of the operation of this vector occurs within the host cell.
[0093] Transformation means introducing DNA into an organism so that the DNA is replicable,
either as an extrachromosomal element or by chromosomal integrant. Depending on the
host cell used, transformation is done using standard techniques appropriate to such
cells. The calcium treatment employing calcium chloride, as described in section 1.82
of Sambrook
et al.,
supra, or electroporation is generally used for prokaryotes or other cells that contain
substantial cell-wall barriers. Infection with
Agrobocterium tumefaciens is used for transformation of certain plant cells, as described by Shaw
et al., Gene,
23:315 (1983) and WO 89/05859 published 29 June 1989. In addition, plants may be transfected
using ultrasound treatment as described in WO 91/00358 published 10 January 1991.
[0094] For mammalian cells without such cell walls, the calcium phosphate precipitation
method of Graham and van der Eb,
Virology,
52:456-457 (1978) is preferred. General aspects of mammalian cell host system transformations
have been described in U.S. Pat. No. 4,399,216 issued 16 August 1983. Transformations
into yeast are typically carried out according to the method of Van Solingen
et al.,
J. Bact.,
130:946 (1977) and Hsiao
et al.,
Proc. Natl. Acad. Sci. (USA),
76:3829 (1979). However, other methods for introducing DNA into cells, such as by nuclear
microinjection. electroporation. bacterial protoplast fusion with intact cells, or
polycations,
e.g., polybrene, polyomithine,
etc., may also be used. For various techniques for transforming mammalian cells, see
Keown
et al.,
Methods in Enzymology, 185:527-537 (1990) and Mansour
et al.,
Nature,
336:348-352 (1988).
D. Culturing the Host Cells
[0095] Prokaryotic cells used to produce the VRP polypeptide of this invention are cultured
in suitable media as described generally in Sambrook
et al., supra.
[0096] The mammalian host cells used to produce the VRP of this invention may be cultured
in a variety of media. Commercially available media such as Ham's F10 (Sigma), Minimal
Essential Medium ([MEM], Sigma), RPMI-1640 (Sigma), and Dulbecco's Modified Eagle's
Medium ([DMEM], Sigma) are suitable for culturing the host cells. In addition, any
of the media described in Ham and Wallace,
Meth. Enz., 58:44 (1979), Bames and Sato,
Anal. Biochem., 102:255 (1980), U.S. Pat. Nos. 4,767,704; 4,657,866; 4,927,762; 4,560,655; or 5,122,469;
WO 90/03430; WO 87/00195; or U.S. Patent Re. 30,985 may be used as culture media for
the host cells. Any of these media may be supplemented as necessary with hormones
and/or other growth factors (such as insulin, transferrin, or epidermal growth factor),
salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such
as HEPES), nucleosides (such as adenosine and thymidine), antibiotics (such as Gentamycin™
drug), trace elements (defined as inorganic compounds usually present at final concentrations
in the micromolar range), and glucose or an equivalent energy source. Any other necessary
supplements may also be included at appropriate concentrations that would be known
to those skilled in the art. The culture conditions, such as temperature, pH, and
the like, are those previously used with the host cell selected for expression, and
will be apparent to the ordinarily skilled artisan.
[0097] In general, principles, protocols, and practical techniques for maximizing the productivity
of mammalian cell cultures can be found in
Mammalian Cell Biotechnology: a Practical Approach, M. Butler, ed. (IRL Press, 1991).
[0098] The host cells referred to in this disclosure encompass cells in culture as well
as cells that are within a host animal.
E. Detecting Gene Amplification/Expression
[0099] Gene amplification and/or expression may be measured in a sample directly, for example,
by conventional Southern blotting, Northern blotting to quantitate the transcription
of mRNA (Thomas,
Proc. Natl. Acad. Sci. USA. 77:5201-5205 [1980]), dot blotting (DNA analysis), or
in situ hybridization, using an appropriately labeled probe, based on the sequences provided
herein. Various labels may be employed, most commonly radioisotopes, particularly
32P. However, other techniques may also be employed, such as using biotin-modified nucleotides
for introduction into a polynucleotide. The biotin then serves as the site for binding
to avidin or antibodies, which may be labeled with a wide variety of labels, such
as radionuclides. fluorescers, enzymes, or the like. Alternatively, antibodies may
be employed that can recognize specific duplexes, including DNA duplexes, RNA duplexes,
and DNA-RNA hybrid duplexes or DNA-protein duplexes. The antibodies in turn may be
labeled and the assay may be carried out where the duplex is bound to a surface, so
that upon the formation of duplex on the surface, the presence of antibody bound to
the duplex can be detected.
[0100] Gene expression, alternatively, may be measured by immunological methods, such as
immunohistochemical staining of tissue sections and assay of cell culture or body
fluids, to quantitate directly the expression of gene product. With immunohistochemical
staining techniques, a cell sample is prepared, typically by dehydration and fixation,
followed by reaction with labeled antibodies specific for the gene product coupled,
where the labels are usually visually detectable, such as enzymatic labels, fluorescent
labels. luminescent labels, and the like. A particularly sensitive staining technique
suitable for use in the present invention is described by Hsu
et al.,
Am. J. Clin. Path., 75:734-738 (1980).
[0101] Antibodies useful for immunohistochemical staining and/or assay of sample fluids
may be either monoclonal or polyclonal, and may be prepared in any mammal. Conveniently,
the antibodies may be prepared against a native VRP polypeptide or against a synthetic
peptide based on the DNA sequences provided herein as described further in Section
4 below.
F. Purification of VRP Polypeptide
[0102] VRP preferably is recovered from the culture medium as a secreted polypeptide, although
it also may be recovered from host cell lysates when directly produced without a secretory
signal. If the VRP is membrane-bound, it can be released from the membrane using a
suitable detergent solution (
e.g. Triton-X 100)
[0103] When VRP is produced in a recombinant cell other than one of human origin, the VRP
is completely free of proteins or polypeptides of human origin. However, it is necessary
to purify VRP from recombinant cell proteins or polypeptides to obtain preparations
that are substantially homogeneous as 10 VRP. As a first step, the culture medium
or lysate is centrifuged to remove particulate cell debris. VRP thereafter is purified
from contaminant soluble proteins and polypeptides, with the following procedures
being exemplary of suitable purification procedures: by fractionation on an ion-exchange
column: ethanol precipitation; reverse phase HPLC; chromatography on silica or on
a cation-exchange resin such as DEAE: chromatofocusing; SDS-PAGE; ammonium sulfate
precipitation; gel filtration using, for example, Sephadex G-75; and protein A Sepharose
columns to remove contaminants such as IgG.
[0104] In die preferred embodiment, the Flt4 receptor-IgG fusion is immobilized on an affinity
chromatography column and the VRP can be isolated by affinity purification using this
column. Alternatively, the VRP is joined at its N-terminus to a glycoprotein D sequence
and is passed through an affinity chromatognphy column on which is immobilized an
anti-gD monoclonal antibody such as 5B6, which is specific for a glycoprotein D sequence.
[0105] VRP variants in which residues have been deleted, inserted, or substituted are recovered
in the same fashion as native VRP, taking account of any substantial changes in properties
occasioned by the variation. For example, preparation of a VRP fusion with another
protein or polypeptide,
e.g., a bacterial or viral antigen, facilitates purification; an immunoaffinity column
containing antibody to the antigen can be used to adsorb the fusion polypeptide. Immunoaffinity
columns such as a rabbit polyclonal anti-VRP column can be employed to absorb the
VRP variant by binding it to at least one remaining immune epitope.
[0106] A protease inhibitor such as phenyl methyl sulfonyl fluoride (PMSF) also may be useful
to inhibit proteolytic degradation during purification. and antibiodcs may be included
to prevent the grown of adventitious contaminants. One skilled in the art will appreciate
that purification methods suitable for native VRP may require modification to account
for changes in the character of VRP or its variants upon expression in recombinant
cell culture.
G. Covalent Modifications of VRP Polypeptides
[0107] Covalent modifications of VRP polypeptides are included within the scope of this
invention. Both native VRP and amino acid sequence variants of the VRP may be covalently
modified. One type of covalent modification of the VRP is introduced into the molecule
by reacting targeted amino acid residues of the VRP with an organic derivatizing agent
that is capable of reacting with selected side chains or the N- or C-terminal residues
of the VRP.
[0108] Cysteinyl residues most commonly are reacted with α-haloacetates (and corresponding
amines), such as chloroacetic acid or chloroacetamide, to give carboxymethyl or carboxyamidomethyl
derivatives. Cysteinyl residues also are derivatized by reaction with bromotrifluoroacetone.
α-bromo-β-(5-imidozoyl)proplonic acid chloroacetyl phosphate, N-alkylmaleimides, 3-nitro-2-pyridyl
disulfide, methyl 2-pyridyl disulfide, p-chloromercuribenzoate, 2-chloromercuri-4-nitrophenol,
or chloro-7-nitrobenzo-2-oxa-1,3-diazole.
[0109] Histidyl residues are derivatized by reaction with diethylpyrocarbonate at pH 5.5-7.0
because this agent is relatively specific for the histidyl side chain. Para-bromophenacyl
bromide also is useful; the reaction is preferably performed in 0.1M sodium cacodylate
at pH 6.0.
[0110] Lysinyl and amino terminal residues are reacted with succinic or other carboxylic
acid anhydrides. Derivatization with these agents has the effect of reversing the
charge of the lysinyl residues. Other suitable reagents for derivatizing α-amino-containing
residues include imidoesters such as methyl picolinimidate, pyridoxal phosphate, pyridoxal,
chloroborohydride, trinitrobenzenesulfonic acid, O-methylisourea, 2,4-pentanedione,
and transaminase-catalyzed reaction with glyoxylate.
[0111] Arginyl residues are modified by reaction with one or several conventional reagents,
among them phenylglyoxal, 2,3-butanedione, 1,2-cyclohexanedione, and ninhydrin. Derivatization
of arginine residues requires that the reaction be performed under alkaline conditions
because of the high pK
a of the guanidine functional group. Furthermore, these reagents may react with the
groups of lysine as well as with the arginine epsilon-amino group.
[0112] The specific modification of tyrosyl residues may be made, with particular interest
in introducing spectral labels into tyrosyl residues by reaction with aromatic diazonium
compounds or tetranitromethane. Most commonly, N-acetylimidizole and tetranitromethane
are used to form O-acetyl tyrosyl species and 3-nitro derivatives, respectively. Tyrosyl
residues are iodinated using
125I or
131I to prepare labeled proteins for use in radioimmunoassay, the chloramine T method
being suitable.
[0113] Carboxyl side groups (aspartyl or glutamyl) are selectively modified by reaction
with carbodiimides (R-N=C=N-R'), where R and R' are different alkyl groups, such as
1-cyclohexyl-3-(2-morpholinyl-4-ethyl) carbodiimide or 1-ethyl-3-(4-azonia-4,4-dimethylpentyl)
carbodiimide. Furthermore, aspartyl and glutamyl residues are converted to asparaginyl
and glutaminyl residues by reaction with ammonium ions.
[0114] Derivatization with bifunctional agents is useful for crosslinking VRP to a water-insoluble
support matrix or surface for use in the method for purifying anti-VRP antibodies,
and vice-versa. Commonly used crosslinking agents include,
e.g., 1,1-bis(diazoacetyl)-2-phenylethane, glutaraldehyde, N-hydroxysuccinimide esters,
for example, esters with 4-azidosalicylic acid, homobifunctional imidoesters, including
disuccinimidyl esters such as 3,3'-dithiobis (succinimidylpropionate), and bifunctional
maleimides such as bis-N-maleimido-1,8-octane. Derivatizing agents such as methyl-3-[(p-azidophenyl)dithio]propioimidate
yield photoactivatable intermediates that are capable of forming crosslinks in the
presence of light. Alternatively, reactive water-insoluble matrices such as cyanogen
bromide-activated carbohydrates and the reactive substrates described in U.S. Patent
Nos. 3,969,287; 3,691,016; 4,195,128; 4,247,642; 4,229,337; and 4,330,440 are employed
for protein immobilization.
[0115] Glutaminyl and asparaginyl residues are frequently deamidated to the corresponding
glutamyl and aspartyl residues, respectively. These residues are deamidated under
neutral or basic conditions. The deamidated form of these residues falls within the
scope of this invention.
[0116] Other modifications include hydroxylation of proline and lysine, phosphorylation
of hydroxyl groups of seryl or threonyl residues. methylation of the α-amino groups
of lysine, arginine, and histidine side chains (T.E. Creighton,
Proteins: Structure and Molecular Properties, W.H. Freeman & Co., San Francisco, pp. 79-86 [1983]), acetylation of the N-terminal
amine, and amidation of any C-terminal carboxyl group.
[0117] Another type of covalent modification of the VRP polypeptide included within the
scope of this invention comprises altering the native glycosylation pattern of the
polypeptide. By altering is meant deleting one or more carbohydrate moieties found
in native VRP, and/or adding one or more glycosylation sites that are not present
in the native VRP.
[0118] Glycosylation of polypeptides is typically either N-linked or O-linked. N-linked
refers to the attachment of the carbohydrate moiety to the side chain of an asparagine
residue. The tripeptide sequences asparagine-X-serine and asparagine-X-threonine,
where X is any amino acid except proline, are the recognition sequences for enzymatic
attachment of the carbohydrate moiety to the asparagine side chain. Thus, the presence
of either of these tripeptide sequences in a polypeptide creates a potaitial glycosylation
site. O-linked glycosylation refers to the attachment of one of the sugars N-aceylgalactosamine,
galactose, or xylose to a hydroxylamino acid. most commonly serine or threonine, although
5-hydroxyproline or 5-hydroxylysine may also be used.
[0119] Addition of glycosylation sites to the VRP polypeptide is conveniently accomplished
by altering the amino acid sequence such that it contains one or more of the above-described
tripeptide sequences (for N-linked glycosylation sites). The alteration may also be
made by the addition of, or substitution by, one or more serine or threonine residues
to the native VRP sequence (for O-linked glycosylation sites). For ease, the VRP amino
add sequence is preferably altered through changes at the DNA level, particularly
by mutating the DNA encoding the VRP polypeptide at preselected bases such that codons
are generated that will translate into the desired amino acids. The DNA mutation(s)
may be made using methods described above and in U.S. Pat. No. 5,364,934,
supra.
[0120] Another means of increasing the number of carbohydrate moieties on the VRP polypeptide
is by chemical or enzymatic coupling of glycosides to the polypeptide. These procedures
are advantageous in that they do not require production of the polypeptide in a host
cell that has glycosylation capabilities for N- or O-linked glycosylation. Depending
on the coupling mode used, the sugar(s) may be attached to (a) arginine and histidine,
(b) free carboxyl groups, (c) free sulfhydryl groups such as those of cysteine, (d)
free hydroxyl groups such as those of serine, threonine, or hydroxyproline, (e) aromatic
residues such as those of phenylalanine, tyrosine, or tryptophan, or (f) the amide
group of glutamine. These methods are described in WO 87/05330 published 11 September
1987, and in Aplin and Wriston,
CRC Crit. Rev. Biochem., pp. 259-306 (1981).
[0121] Removal of carbohydrate moieties present on the VRP polypeptide may be accomplished
chemically or enzymatically. Chemical deglycosylation requires exposure of the polypeptide
to the compound trifluoromethanesulfonic acid. or an equivalent compound. This treatment
results in the cleavage of most or all sugars except the linking sugar (N-acetylglucosamine
or N-acetylgalactosamine), while leaving the polypeptide intact. Chemical deglycosylation
is described by Hakimuddin,
et al.,
Arch. Biochem, Biophys., 259:52 (1987) and by Edge
et al., Anal. Biochem.,
118:131 (1981). Enzymatic cleavage of carbohydrate moieties on polypeptides can be achieved
by the use of a variety of endo- and exo-glycosidases as described by Thotakura
et al.,
Meth. Enzymol.,
138:350 (1987).
[0122] Glycosylation at potential glycosylation sites may be prevented by the use of the
compound tunicamycin as described by Duskin
et al., J. Biol. Chem.,
257:3105 (1982). Tunicamycin blocks the formation of protein-N-glycoside linkages.
[0123] Another type of covalent modification of VRP comprises linking the VRP polypeptide
to one of a variety of nonproteinaceous polymers,
e.g., polyethylene glycol, polypropylene glycol, or polyoxyalkylenes, in the manner set
forth in U.S. Patent Nos. 4,640,835; 4,496,689; 4,301,144; 4,670,417; 4,791,192 or
4,179,337.
[0124] Since it is often difficult to predict in advance the characteristics of a variant
VRP, it will be appreciated that some screening of the recovered variant will be needed
to select the optimal variant. A change in the immunological character of the VRP
molecule, such as affinity for a given antibody, is also able to be measured by a
competitive-type immunoassay. The variant is assayed for changes in the suppression
or enhancement of its mitogenic activity by comparison to the activity observed for
native VRP in the same assay. For example, one can screen for the ability of the variant
VRP to stimulate protein kinase activity of the Flt4 receptor as described in Example
5 herein. Other potential modifications of protein or polypeptide properties such
as redox or thermal stability, hydrophobicity, susceptibility to proteolytic degradation,
or the tendency to aggregate with carriers or into multimers are assayed by methods
well known in the art.
H. Epitope-tagged VRP
[0125] This invention encompasses chimeric polypeptides comprising VRP fused to another
polypeptide. In one preferred embodiment, the chimeric polypeptide comprises a fusion
of the VRP with a tag polypeptide which provides an epitope to which an anti-tag antibody
can selectively bind. The epitope tag is generally placed at the amino- or carboxyl-
terminus of the VRP. Such epitope-tagged forms of the VRP are desirable, as the presence
thereof can be detected using a labeled antibody against the tag polypeptide. Also,
provision of the epitope tag enables the VRP to be readily purified by affinity purification
using the anti-tag antibody. Affinity purification techniques and diagnostic assays
involving antibodies are described later herein.
[0126] Tag polypeptides and their respective antibodies are well known in the art. Examples
include the flu HA tag polypeptide and its antibody 12CA5 (Field
et al.,
Mol. Cell. Biol., 8:2159-2165 [1988]); the c-myc tag and the 8F9, 3C7, 6E10, G4, B7 and 9E10 antibodies
thereto (Evan
et al.,
Molecular and Cellular Biology,
5:3610-3616 [1985]); and the Herpes Simplex virus glycoprotein D (gD) tag and its antibody.
Paborsky
et al., Protein Engineering,
3(6):547-553 (1990). Other tag polypeptides have been disclosed. Examples include the
Flag-peptide (Hopp
et al.,
BioTechnology,
6:1204-1210 [1988]); the KT3 epitope peptide (Martin
et al.,
Science,
255:192-194 [1992]); an α-tubulin epitope peptide (Skinner
et al.,
J. Biol. Chem., 266:15163-15166 [1991]); and the T7 gene 10 protein peptide tag. Lutz-Freyermuth
et al.,
Proc. Natl. Acad. Sci USA,
87:6393-6397 (1990). Once the tag polypeptide has been selected, an antibody thereto
can be generated using the techniques disclosed herein.
[0127] The general methods suitable for the construction and production of epitope-tagged
VRP are the same as those disclosed hereinabove with regard to (native or variant)
VRP. VRP-tag polypeptide fusions are most conveniently constructed by fusing the cDNA
sequence encoding the VRP portion in-frame to the tag polypeptide DNA sequence and
expressing the resultant DNA fusion construct in appropriate host cells. Ordinarily,
when preparing the VRP-tag polypeptide chimeras of the present invention, nucleic
acid encoding the VRP will be fused at its 3' end to nucleic acid encoding the N-terminus
of the tag polypeptide, however 5' fusions are also possible.
[0128] Epitope-tagged VRP can be conveniently purified by affinity chromatography using
the anti-tag antibody. The matrix to which the affinity antibody is attached is most
often agarose, but other matrices are available (
e.g. controlled pore glass or poly(styrenedivinyl)benzene). The cpitope-tagged VRP can
be eluted from the affinity column by varying the buffer pH or ionic strength or adding
chaotropic agents, for example.
2. Therapeutic Uses, Compositions, and Administration of VRP
[0129] VRP is believed to find therapeutic use for treating mammals via stimulation or inhibition
of growth and/or differentiation and/or activation of cells having the Flt4 receptor
or one or more other VRP receptors. Exogenous VRP may be administered to a patient
in these circumstances. The human VRP is clearly useful insofar as it can be administered
to a human having depressed levels of endogenous VRP, preferably in the situation
where such depressed levels lead to a pathological disorder, or where there is lack
of activation or inhibition of the Flt4 receptor or one or more other VRP receptors.
[0130] Various potential therapeutic uses of VRP include those in which VEGF is useful.
Examples of these include uses associated with the vascular endothelium, such as the
treatment of traumata to the vascular network, in view of the demonstrated rapid promotion
by VEGF of the proliferation of vascular endothelial cells that would surround the
traumata and in view of the relationship between VEGF and the VRP established herein.
Examples of such traumata that could be so treated include, but are not limited to,
surgical incisions, particularly those involving the heart, wounds, including lacerations,
incisions, and penetrations of blood vessels, and surface ulcers involving the vascular
endothelium such as diabetic, haemophiliac, and varicose ulcers. Other physiological
conditions that could be improved based on the selective mitogenic character of the
VRP are also included herein.
[0131] For the traumatic indications referred to above, the VRP molecule will be formulated
and dosed in a fashion consistent with good medical practice taking into account the
specific disorder to be treated, the condition of the individual patient, the site
of delivery of the VRP, the method of administration, and other factors known to practitioners.
[0132] Additional indications for the VRP are in the treatment of full-thickness wounds
such as dermal ulcers, including the categories of pressure sores, venous ulcers,
and diabetic ulcers, as well as of full-thickness bums and injuries where angiogenesis
is required to prepare the burn or injured site for a skin graft or flap. In this
case the VRP is either applied directly to the site or it is used to soak the skin
or flap that is being transplanted prior to grafting. In a similar fashion, the VRP
can be used in plastic surgery when reconstruction is required following a burn or
other trauma, or for cosmetic purposes.
[0133] Angiogenesis is also important in keeping wounds clean and non-infected. The VRP
can therefore be used in association with general surgery and following the repair
of cuts and lacerations. It is particularly useful in the treatment of abdominal wounds
with a high risk of infection. Neovascutarization is also key to fracture repair,
since blood vessels develop at the site of bone injury. Administration of die VRP
to the site of a fracture is therefore another utility.
[0134] In cases where the VRP is being used for topical wound healing, as described above,
it may be administered by any of the routes described below for the re-endothelialization
of vascular tissue, or more preferably by topical means. In these cases, it will be
administered as either a solution, spray, gel, cream, ointment, or dry powder directly
to the site of injury. Slow-release devices directing the VRP to the injured site
will also be used. In topical applications, the VRP will be applied at a concentration
ranging from about 50 to 1,000 µg/mL, either in a single application, or in dosing
regimens that are daily or every few days for a period of one week to several weeks.
Generally, the amount of topical formulation administered is that which is sufficient
to apply from about 0.1 to 100 µg/cm
2 of the VRP, based on the surface area of the wound.
[0135] The VRP can be used as a post-operative wound healing agent in balloon angioplasty,
a procedure in which vascular endothelial cells are removed or damaged, together with
compression of atherosclerotic plaques. The VRP can be applied to inner vascular surfaces
by systemic or local, intravenous application either as intravenous bolus injection
or infusions. If desired, the VRP can be administered over time using a mterometering
pump. Suitable compositions for intravenous administration comprise the VRP in an
amount effective to promote endothelial cell growth and a parenteral carrier material.
The VRP can be present in the composition over a wide range of concentrations, for
example, from about 50 µg/mL to about 1,000 µg/mL using injections of 3 to 10 mL per
patient, administered once or in dosing regimens that allow for multiple applications.
Any of the known parenteral carrier vehicles can be used, such as normal saline or
5-10% dextrose.
[0136] The VRP can also be used to promote endothelialization in vascular graft surgery.
In the case of vascular grafts using either transplanted vessels or synthetic material,
for example, the VRP can be applied to the surfaces of the graft and/or at the junctions
of the graft and the existing vasculature to promote the growth of vascular endothelial
cells. For such applications, the VRP can be applied intravenously as described above
for balloon angioplasty or it can be applied directly to the surfaces of the graft
and/or the existing vasculature either before or during surgery. In such cases it
may be desired to apply the VRP in a thickened carrier material so that it will adhere
to the affected surface. Suitable carrier materials include, for example, 1-5% carbopol.
The VRP can be present in the carrier over a wide range of concentrations, for example,
from about 50 µg/mg to about 1,000 µg/mg. Alternatively, the VRP can be delivered
to the site by a micrometering pump as a parenteral solution.
[0137] The VRP can also be employed to repair vascular damage following myocardial infarction
and to circumvent the need for coronary bypass surgery by stimulating the growth of
a collateral circulation. The VRP is administered intravenously for this purpose,
either in individual injections or by micrometering pump over a period of time as
described above or by direct infusion or injection to the site of damaged cardial
muscle.
[0138] Therapeutic formulations of VRP are prepared for storage by mixing VRP having the
desired degree of purity with optional physiologically acceptable carriers, excipients,
or stabilizers (
Remington's Pharmaceutical Sciences, 16th edition, Osol, A., Ed., [1980]), in the form of lyophilized cake or aqueous
solutions. Acceptable carriers, excipients, or stabilizers are nontoxic to recipients
at the dosages and concentrations employed, and include buffers such as phosphate,
citrate, and other organic acids; antioxidants including ascorbic acid; low molecular
weight (less than about 10 residues) polypeptides; proteins, such as serum albumin,
gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino
acids such as glycine, glutamine, asparagine, arginine, or lysine: monosaccharides,
disaccharides. and other carbohydrates including glucose, mannose, or dextrins; chelating
agents such as EDTA; sugar alcohols such as mannitol or sorbitol: salt-forming counter-ions
such as sodium: and/or non-ionic surfactants such as Tween, Pluronics or polyethylene
glycol (PEG).
[0139] The VRP also may be entrapped in microcapsules prepared, for example, by coacervation
techniques or by interfacial polymerization (for example, hydroxymethylcellulose or
gelatin-microcapsules and poly-[methyhnethacylate] microcapsules. respectively), in
colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions,
nano-particles, and nanocapsules), or in macroemulsions. Such techniques are disclosed
in
Remington's Pharmaceutical Sciences, supra.
[0140] VRP to be used for
in vivo administration must be sterile. This is readily accomplished by filtration through
sterile filtration membranes, prior to or following lyophilization and reconsmution.
VRP ordinarily will be stored in lyophilized form or in solution.
[0141] Therapeutic VRP compositions generally are placed into a container having a sterile
access port, for example, an intravenous solution bag or vial having a stopper pierceable
by a hypodermic injection needle.
[0142] The route of VRP administration is in accord with known methods,
e.g., those routes set forth above for specific indications, as well as the general routes
of injection or infusion by intravenous, intraperitoneal, intracerebral, intramuscular,
intraocular, intraarterial, or intralesional means, or sustained release systems as
noted below. VRP is administered continuously by infusion or by bolus injection. Generally,
where the disorder permits, one should formulate and dose the VRP for site-specific
delivery. This is convenient in the case of wounds and ulcers.
[0143] Suitable examples of sustained-release preparations include semipermeable matrices
of solid hydrophobic polymers containing the protein, which matrices are in the form
of shaped articles,
e.g., films, or microcapsules. Examples of sustained-relcase matrices include polyesters.
hydrogels [
e.
g., poly(2-hydroxyethylmethacrylate) as described by Langer
et al.,
J. Biomed. Mater. Res.,
15: 167-277 (1981) and Longer,
Chem. Tech.,
12:98-105 (1982) or poly(vinylalcohol)], polylactides (U.S. Patent No. 3,773,919, EP
58,481), copolymers of L-glutamic acid and gamma ethyl-L-glinamate (Sidman
et al.,
Biopolymers,
22:547-556 [1983]), non-degradable ethylene-vinyl acetate (Langer
et al.,
supra), degradable lactic acid-glycolic acid copolymers such as the Lupron Depot™ (injectable
microspberes composed of lactic acid-glycolic acid copolymer and leuprolide acetate),
and poly-D-(-)-3-hydroxybutyric acid (EP 133,988).
[0144] White polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable
release of molecules for over 100 days, certain hydrogels release proteins for shorter
time periods. When encapsulated proteins remain in the body for a long time, they
may denature or aggregate as a insult of exposure to moisture at 37°C, resulting in
a loss of biological activity and possible changes in immunogenicity. Rational strategies
can be devised for protein stabilization depending on the mechanism involved. For
example, if the aggregation mechanism is discovered to be intermolecular S-S bond
formation through thio-disulfide interchange, stabilization may be achieved by modifying
sulfliydryl residues, lyophilizing from acidic solutions, controlling moisture content,
using appropriate additives, and developing specific polymer matrix compositions.
[0145] Sustained-release VRP compositions also include liposomally entrapped VRP. Liposomes
containing VRP are prepared by methods known
per se: DE 3,218,121; Epstein
et al.,
Proc. Natl. Acad. Sci. USA. 82:3688-3692 (1985); Hwang
et al.,
Proc. Natl. Acad. Sci. USA. 77:4030-4034 (1980); EP 52,322; EP 36,676; EP 88,046; EP 143,949; EP 142,641; Japanese
patent application 83-118008; U.S. Patent Nos. 4,485,045 and 4,544,545; and EP 102,324.
Ordinarily the liposomes are of the small (about 200-800 Angstroms) unilamellar type
in which the lipid content is greater than about 30 mol. % cholesterol, the selected
proportion being adjusted for the optimal VRP therapy.
[0146] When applied topically, the VRP is suitably combined with other ingredients, such
as carriers and/or adjuvants. There are no limitations on the nature of such other
ingredients, except that they must be pharmaceutically acceptable and efficacious
for their intended administration, and cannot degrade the activity of the active ingredients
of the composition. Examples of suitable vehicles include ointments, creams, gels,
or suspensions, with or without purified collagen. The compositions also may be impregnated
into transdermal patches, plasters, and bandages, preferably in liquid or semi-liquid
form.
[0147] For obtaining a gel formulation, the VRP formulated in a liquid composition may be
mixed with an effective amount of a water-soluble polysaccharide or synthetic polymer
such as PEG to form a gel of the proper viscosity to be applied topically. The polysaccharide
that may be used includes, for example, cellulose derivatives such as etherifed cellulose
derivatives, including alkyl celluloses, hydroxyalkyl celluloses, and alkylhydroxyalkyl
celluloses, for example, methylcellulose, hydroxyethyl cellulose, carboxymethyl cellulose,
hydroxypropyl methylcellulose, and hydroxypropyl cellulose; starch and fractionated
starch; agar; alginic acid and alginates; gum arabic; pullullan; agarose; carrageenan;
dextrans; dextrins; fructans; inulin; mannans; xylans; arabinans; chitosans; glycogens;
glucans; and synthetic biopolymers; as well as gums such as xanthan gum; guar gum;
locust bean gum; gum arabic; tragacanth gum; and karaya gum; and derivatives and mixtures
thereof. The preferred gelling agent herein is one that is inert to biological systems,
nontoxic, simple to prepare, and not too runny or viscous, and will not destabilize
the VRP held within it.
[0148] Preferably the polysaccharide is an etherified cellulose derivative, more preferably
one that is well defined, purified, and listed in USP, e.g., methylcellulose and the
hydroxyalkyl cellulose derivatives, such as hydroxypropyl cellulose, hydroxyethyl
cellulose, and hydroxypropyl methylcellulose. Most preferred herein is methylcellulose.
[0149] The polyethylene glycol useful for gelling is typically a mixture of low and high
molecular weight PEGs to obtain the proper viscosity. For example, a mixture of a
PEG of molecular weight 400-600 with one of molecular weight 1500 would be effective
for this purpose when mixed in the proper ratio to obtain a paste.
[0150] The term "water soluble" as applied to the polysaccharides and PEGs is meant to include
colloidal solutions and dispersions. In general, the solubility of the cellulose derivatives
is determined by the degree of substitution of ether groups, and the stabilizing derivatives
useful herein should have a sufficient quantity of such ether groups per anhydroglucose
unit in the cellulose chain to render the derivatives water soluble. A degree of ether
substitution of at least 0.35 ether groups per anhydroglucose unit is generally sufficient.
Additionally, the cellulose derivatives may be in the form of alkali metal salts,
for example, the Li, Na, K, or Cs salts.
[0151] If mothylcellulose is employed in the gel, preferably it comprises about 2-5%, more
preferably about 3%, of the gel and the VRP is present in an amount of about 300-1000
mg per ml of gel.
[0152] An effective amount of VRP to be employed therapeutically will depend, for example,
upon the therapeutic objectives, the route of administration, and the condition of
the patient. Accordingly, it will be necessary for the therapist to titer the dosage
and modify the route of administration as required to obtain the optimal therapeutic
effect. Typically, the clinician will administer the VRP until a dosage is reached
that achieves the desired effect. A typical daily dosage for systemic treatment might
range from about 1 µg/kg to up to 10 mg/kg or more. depending on the factors mentioned
above. As an ahemative general proposition, the VRP is formulated and delivered to
the target site or tissue at a dosage capable of establishing in the tissue a VRP
level greater than about 0.1 ng/cc up to a maximum dose that is efficacious but not
unduly toxic. This intra-tissue concentration should be maintained if possible by
continuous infusion, sustained release, topical application, or injection at empirically
determined frequencies. The progress of this therapy is easily monitored by conventional
assays.
[0153] It is within the scope hereof to combine the VRP therapy with other novel or conventional
therapies (e.g., growth factors such as VEGF, acidic or basic fibroblast growth factor
(aFGF or bFGF, respectively), platelet-derived growth factor (PDGF), insulin-like
growth factor (IGF-I or IGF-II), nerve growth factor (NGF), anabolic steroids, EGF
or TGF-α) for enhancing the activity of any of the growth factors, including the VRP,
in promoting cell proliferation and repair. It is not necessary that such co-treatment
drugs be included
per se in the compositions of this invention, although this will be convenient where such
drugs are proteinaceous. Such admixtures are suitably administered in the same manner
and for the same purposes as the VRP used alone. The useful molar ratio of VRP to
such secondary growth factors is typically 1:0.1-10, with about equimolar amounts
being preferred.
3. Non-Therapeutic, Diagnostic Uses for VRP
[0154] The nucleic acid encoding the VRP may be used as a diagnostic for tissue-specific
typing. For example, such procedures as
in situ hybridization, Northern and Southern blotting, and PCR analysis may be used to determine
whether DNA and/or RNA encoding VRP is present in the cell type(s) being evaluated.
VRP nucleic acid or polypeptide may also be used as diagnostic markers. For example,
the VRP may be labeled, using the techniques described herein, and expression of nucleic
acid molecules encoding a Flt4 receptor or another VRP receptor can be quantified,
using the labelled VRP.
[0155] If the human VRP-encoding nucleic acid is localized to a human chromosome. the nucleic
acid for human VRP can be used as a marker for this human chromosome.
[0156] VRP nucleic acid is also useful for the preparation of VRP polypeptide by recombinant
techniques exemplified herein.
[0157] Isolated VRP polypeptide may be used in quantitative diagnostic assays as a standard
or control against which samples containing unknown quantities of VRP may be prepared.
[0158] VRP preparations are also useful in generating antibodies, as standards in assays
for VRP (
e.g., by labeling VRP for use as a standard in a Fadioimmunoassay, radioreceptor assay,
or enzyme-linked immunoassay), for detecting the presence of the Flt4 receptor or
one or more other VRP receptors in a biological sample (
e.g., using a labeled VRP), in affinity purification techniques, and in competitive-type
receptor binding assays when labeled with radioiodine, enzymes, fluorophores, spin
labels, or the like.
[0159] The VRP is also useful as a diagnostic tool. For example, the VRP can be produced
in prokaryotic cells using the techniques elaborated herein and the unglycosylated
protein so produced can be used as a molecular weight marker. The deduced molecular
weight (mw) of the VRP is about 44.8 kDa. To use the VRP as a molecular weight marker,
gel filtration chromatography or SDS-PAGE. for example, will be used to separate protein(s)
for which it is desired to determine their molecular weight(s) in substantially the
normal way. The VRP and other molecular weight markers will be used as standards to
provide a range of molecular weights. For example, phosphorylase b (mw = 97,400),
bovine serum albumin (mw = 68,000), ovalbumin (mw = 46,000), VRP (mw = 44,800), trypsin
inhibitor (mw = 20,100), and lysozyme (mw = 14,400) can be used a mw markers. The
other molecular weight markers mentioned here can be purchased commercially from Amersham
Corporation, Arlington Heights, 1L, for example. Often. the molecular weight markers
will be labeled to enable easy detection following separation. Techniques for labeling
antibodies and proteins are discussed herein and are well known in the art. For example,
the molecular weight markers may be blotinylated and, following separation on SDS-PAGE,
for example, the blot can be incubated with streptavidin-horseradish peroxidase. The
bands can then be detected by light detection.
[0160] It may also be useful to grow certain cells having the Flt4 receptor or one or more
other VRP receptors
ex vivo using the VRP as an angiogenic factor or growth factor. Thus, for example, the VRP
can be used as a growth factor in the
in vitro culturing of endothelial cells. For such uses, the VRP can be added to the cell culture
medium at a concentration from about 10 pg/mL to about 10 ng/mL.
[0161] These cells which are to be grown
ex vivo may simultaneously be exposed to other known growth factors or cytokines. Exemplary
cytokines include the interleukins (
e.g., IL-3), granulocyte-macrophage colony-stimulating factor (GM-CSF), VEGF, macrophage
colony-stimulating factor (M-CSF), granulocyte colony-stimulating factor (G-CSF),
granulocyte-macrophage colony-stimulating factor (GM-CSF), erythropoietin (Epo), lymphotoxin,
steel factor (SLF), tumor necrosis factor (TNF), and gamma-interferon. This results
in proliferation and/or differentiation of the cells having the Flt4 receptor or one
or more other VRP receptors.
[0162] In yet another aspect of the invention, the VRP may be used for affinity purification
of the Flt4 receptor or one or more other VRP receptors. Briefly, this technique involves
covalently attaching the VRP to an inert and porous matrix (
e.g., agarose reacted with cyanogen bromide). A solution containing the Flt4 receptor
or other VRP receptor(s) can then be passed through the chromatographic material and
can be subsequently released by changing the elution conditions (
e.g. by changing pH or ionic strength).
[0163] The purified VRP. and the nucleic acid encoding it, may also be sold as reagents
for mechanism studies of VRP and its cognate receptors, to study the role of the VRP
and the Flt4 receptor or other VRP receptors in normal growth and development, as
well as abnormal growth and development,
e.g. in malignancies.
[0164] The VRP may be used for competitive screening of potential agonists or antagonists
for binding to the Flt4 receptor or other VRP receptors. VRP variants are useful as
standards or controls in assays for the VRP, provided that they are recognized by
the analytical system employed,
e.g. an anti-VRP antibody.
4. VRP Antibody Preparation
[0165] A description follows as to the production of exemplary antibodies as defined herein.
These exemplary antibodies include polyclonal, monoclonal, humanized, bispecific,
or heteroconjugate antibodies.
A. Polyclonal Antibodies
[0166] Polyclonal antibodies to the VRP generally are raised in animals by multiple subcutaneous
(sc) or intraperitoneal (ip) injections of the VRP and an adjuvant. It may be useful
to conjugate the VRP to a protein that is immunogenic in the species to be immunized,
e.g., keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, or soybean trypsin
inhibitor using a bifunctional or derivatizing agent, for example maleimidobenzoyl
sulfosuccinimide ester (conjugation through cysteine residues), N-hydroxysuccinimide
(through lysine residues), glytaraldehyde, succinic anhydride, SOCl
2, or R
1N=C=NR, where R and R
1 are different alkyl groups.
[0167] Animals are immunized against the immunogenic conjugates or derivatives by combinine
1 mg of 1 µg of conjugate (for rabbits or mice, respectively) with 3 volumes of Freud's
complete adjuvant and injecting the solution intradermally at multiple sites. One
month later the animals are boosted with 1/5 to 1/10 the original amount of conjugate
in Freud's complete adjuvant by subcutaneous injection at multiple sites. Seven to
14 days later the animate are bled and the serum is assayed for anti-VRP antibody
titer. Animals are boosted until the titer plateaus. Preferably, the animal is boosted
with a conjugate of the same VRP with a different protein and/or the conjugation is
through a different cross-linking reagent. Conjugates also can be made in recombinant
cell culture as protein fusions. Also, aggregating agents such as alum are used to
enhance the immune response.
B. Monoclonal Antibodies
[0168] Monoclonal antibodies are obtained from a population of substantially homogeneous
antibodies,
i.e., the individual antibodies comprising the population are identical except for possible
naturally-occurring mutations that may be present in minor amounts. Thus, the modifier
"monoclonal" indicates the character of the antibody as not being a mixture of discrete
antibodies.
[0169] For example, the anti-VRP monoclonal antibodies of the invention may be made using
the hybridoma method first described by Kohler and Milstein,
Nature,
256:495 (1975), or may be made by recombinant DNA methods. U.S. Pat. No. 4,816,567.
[0170] In the hybridoma method, a mouse or other appropriate host animal, such as hamster,
is immunized as hereinabove described to elicit lymphocytes that produce, or are capable
of producing, antibodies that will specifically bind to the protein used for immunization.
Alternatively, lymphocytes may be immunized
in vitro. Lymphocytes then are fused with myeloma cells using a suitable rosing agent, such
as PEG, to form a hybridoma cell Goding,
Monoclonal Antibodies: Principles and Practice, pp.59-103 (Academic Press, 1986).
[0171] The hybridoma cells thus prepared are seeded and grown in a suitable culture medium
that preferably contains one or more substances that inhibit the growth or survival
of the unfused, parental myeloma cells. For example, if the parental myeloma cells
lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the
culture medium for the hybridomas typically will include hypoxanthine, aminopterin.
and thymidine (HAT medium), which substances prevent the growth of HGPRT-deficient
cells.
[0172] Piefencd myeloma cells are those that fuse efficiently, support stable high-level
expression of antibody by me selected antibody-producing cells, and are sensitive
to a medium such as HAT medium. Among these, preferred myeloma cell lines are murine
myeloma lines, such as those derived from MOPC-21 and MPC-11 mouse tumors available
from the Salk Institute Cell Distribution Center, San Diego, California USA, and SP-2
cells available from the American Type Culture Collection, Rockville, Maryland USA.
Human myeloma and mouse-human heteromyeloma cell lines also have been described for
the production of human monoclonal antibodies. Kozbor,
J. Immunol., 133:3001 (1984); Brodeur
et al.,
Monoclonal Antibody Production Techniques and Applications, pp.51-63 (Marcel Dekker, Inc., New York, 1987). See, also, Boerner
et al.,
J. Immunol., 147:86-95 (1991) and WO 91/17769, published 28 November 1991. for techniques for the
production of human monoclonal antibodies.
[0173] Culture medium in which hybridoma cells are growing is assayed for production of
monoclonal antibodies directed against VRP. Preferably, the binding specificity of
monoclonal antibodies produced by hybridoma cells is determined by immunoprecipitation
or by an
in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay
(ELISA).
[0174] The binding affinity of the monoclonal antibody can. for example, be determined by
the Scatchard analysis of Munson and Pollard,
Anal. Biochem., 107:220 (1980).
[0175] After hybridoma cells are identified that produce antibodies of the desired specificity,
affinity, and/or activity, the clones may be subcloned by limiting dilution procedures
and grown by standard methods. Goding,
Monoclonal Antibodies: Principles and Practice, pp.59-104 (Academic Press, 1986). Suitable culture media for this purpose include,
for example, Dulbecco's Modified Eagle's Medium or RPMI-1640 medium. In addition,
the hybridoma cells may be grown
in vivo as ascites tumors in an animal.
[0176] The monoclonal antibodies secreted by the subclones are suitably separated from the
culture medium, ascites fluid, or serum by conventional immunoglobulin purification
procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography,
gel electrophoresis, dialysis, or affinity chromatography.
[0177] Alternatively, it is now possible to produce transgenic animals (
e.g. mice) that are capable, upon immunization, of producing a full repertoire of human
antibodies in the absence of endogenous immunoglobulin production. For example, it
has been described that the homozygous deletion of the antibody heavy chain joining
region (J
H) gene in chimeric and germ-line mutant mice results in complete inhibition of endogenous
antibody production. Transfer of the human germ-line immunoglobulin gene array in
such germ-line mutant mice will result in the production of human antibodies upon
antigen challenge. See,
e.g. Jakobovits
et al., Proc. Natl. Acad. Sci. USA.
90:2551-255 (1993); Jakobovits
et al.,
Nature,
362:255-258 (1993).
[0178] In a further embodiment. antibodies or antibody fragments can be isolated from antibody
phage libraries generated using the techniques described in McCafferty
et al., Nature,
348:552-554 (1990), using the VRP to select for a suitable antibody or antibody fragment.
Clackson
et al.,
Nature,
352:624-628 (1991) and Marks
et al.,
J. Mol. Biol.,
222:581-597(1991) describe the isolation of murine and human antibodies, respectively,
using phage libraries. Subsequent publications describe the production of high-affinity
(nM range) human antibodies by chain shuffling (Mark
et al.,
Bio/Technol.,
10:779-783 [1992]), as well as combinatorial infection and
in vivo recombination as a strategy for constructing very large phage libraries. Waterhouse
et al., Nuc. Acids Res.,
21:2265-2266 (1993). Thus, these techniques are viable alternatives to traditional monoclonal
antibody hybridoma techniques for isolation of "monoclonal" antibodies (especially
human antibodies) that are encompassed by the present invention.
[0179] DNA encoding the monoclonal antibodies of the invention is readily isolated and sequenced
using conventional procedures (
e.g., by using oligonucleotide probes that are capable of binding specifically to genes
encoding the heavy and light chains of marine antibodies). The hybridoms cells of
the invention serve as a preferred source of such DNA. Once isolated, the DNA may
be placed into expression vectors, which are then transfected into host cells such
as simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not
otherwise produce immunoglobulin protein. to obtain the synthesis of monoclonal antibodies
in the recombinant host cells. The DNA also may be modified, for example, by substituting
the coding sequence for human heavy- and light-chain constant domains in place of
the homologous murine sequences (Morrison
et al., Proc. Nat. Acad. Sci. USA,
81, 6851 [1984]), or by covalently joining to the immunoglobulin coding sequence all
or part of the coding sequence for a non-immunoglobulin polypeptide. In that manner,
"chimeric" or "hybrid" antibodies are prepared that have the binding specificity of
an anti-VRP monoclonal antibody herein.
[0180] Typically, such non-immunoglobulin polypeptides are substituted for the constant
domains of an antibody of the invention, or they are substituted for the variable
domains of one antigen-combining site of an antibody of the invention to create a
chimeric bivalent antibody comprising one antigen-combining site having specificity
for an VRP and another antigen-combining site having specificity for a different antigen.
[0181] Chimeric or hybrid antibodies also may be prepared
in vitro using known methods in synthetic protein chemistry, including those involving crosslinking
agents. For example, immunotoxins may be constructed using a disulfide exchange reaction
or by forming a thioether bond. Examples of suitable reagents for this purpose include
iminothiolate and methyl-4-mercaptobutyrimidate.
[0182] For diagnostic applications, the antibodies of the invention typically will be labeled
with a detectable moiety. The detectable moiety can be any one which is capable of
producing, either directly or indirectly, a detectable signal. For example, the detectable
moiety may be a radioisotope, such as
3H,
14C,
32P,
35S, or
125I; a fluorescent or chemiluminescent compound, such as fluorescein isothiocyanate,
rhodamine, or luciferin: or an enzyme, such as alkaline phosphatase, beta-galactosidase,
or horseradish peroxidase.
[0183] Any method known in the art for separately conjugating the antibody to the detectable
moiety may be employed, including those methods described by Hunter
et al.,
Nature, 144:945(1962); David
et al.,
Biochemistry,
13:1014 (1974); Pain
et al.,
J. Immunol. Meth.,
40:219 (1981); and Nygren,
J. Histochem. and Cytochem.,
30:407 (1982).
[0184] The antibodies of the present invention may be employed in any known assay method,
such as competitive binding assays, direct and indirect sandwich assays, and immunoprecipitation
assays. Zola,
Monoclonal Antibodies: A Manual of Techniques, pp.147-158 (CRC Press. Inc., 1987).
[0185] Competitive binding assays rely on the ability of a labeled standard (which may be
a VRP, or an immunologically reactive portion thereof) to compete with the test sample
analyte (VRP) for binding with a limited amount of antibody. The amount of VRP in
the test sample is inversely proportional to the amount of standard that becomes bound
to the antibodies. To facilitate determining the amount of standard that becomes bound,
the antibodies generally are insolubilized before or after the competition, so that
the standard and analyte that are bound to the antibodies may conveniently be separated
from the standard and analyte which remain unbound.
[0186] Sandwich assays involve the use of two antibodies, each capable of binding to a different
immunogenic portion, or epitope, of the protein to be detected (VRP). In a sandwich
assay, the test sample analyte is bound by a first antibody which is immobilized on
a solid support, and thereafter a second antibody binds to the analyte, thus forming
an insoluble three-part complex. See,
e.g., US Pat No. 4,376,110. The second antibody may itself be labeled with a detectable
moiety (direct sandwich assays) or may be measured using an anti-immunoglobulin antibody
that is labeled with a detectable moiety (indirect sandwich assay). For example, one
type of sandwich assay is an ELISA assay, in which case the detectable moiety is an
enzyme.
C Humanized Antibodies
[0187] Methods for humanizing non-human antibodies are well known in the art. Generally,
a humanized antibody has one or more amino acid residues introduced into it from a
source which is non-human. These non-human amino acid residues are often referred
to as "import" residues, which are typically taken from an "import" variable domain.
Humanization can be essentially performed following the method of Winter and co-workers
(Jones
et al.,
Nature,
321:522-525 [1986]; Riechmann
et al.,
Nature,
332:323-327 [1988]; Verhoeyen
et al.,
Science,
239:1534-1536 [1988]), by substituting rodent CDRs or CDR sequences for the corresponding
sequences of a human antibody. Accordingly, such "humanized" antibodies are chimeric
antibodies (U.S. Pat. No. 4,816,567,
supra), wherein substantially less than an intact human variable domain has been substituted
by the corresponding sequence from a non-human species. In practice, humanized antibodies
are typically human antibodies in which some CDR residues, and possibly some FR residues,
are substituted by residues from analogous sites in rodent antibodies.
[0188] It is important that antibodies be humanized with retention of high affinity for
the antigen and other favorable biological properties. To achieve this goal, according
to a preferred method, humanized antibodies are prepared by a process of analysis
of the parental sequences and various conceptual humanized products using three-dimensional
models of the parental and humanized sequences. Three-dimensional immunoglobulin models
are familiar to those skilled in the art. Computer programs are available which illustrate
and display probable three-dimensional conformational structures of selected candidate
immunoglobulin sequences. Inspection of these displays permits analysis of the likely
role of the residues in the functioning of the candidate immunoglobulin sequence,
i.e., the analysis of residues that influence the ability of the candidate immunoglobulin
to bind its antigen. In this way, FR residues can be selected and combined from the
consensus and import sequence so that the desired antibody characteristic, such as
increased affinity for the target antigen(s), is achieved. In general, the CDR residues
are directly and most substantially involved in influencing antigen binding. For further
details see WO 92/22653, published 23 December 1992.
D. Bispecific Antibodies
[0189] Bispecific antibodies are monoclonal, preferably human or humanized, antibodies that
have binding specificities for at least two different antigens. In the present case,
one of the binding specificities is for the VRP, the other one is for any other antigen,
and preferably for a receptor or receptor subunit. For example, bispecific antibodies
specifically binding the Flt4 receptor and the VRP are within the scope of the present
invention.
[0190] Methods for making bispecific antibodies are known in the art. Traditionally, the
recombinant production of bispecific antibodies is based on the co-expression of two
immunoglobulin heavy-chain/light-chain pairs, where the two heavy chains have different
specificities. Millstein and Cuello,
Nature,
305:537-539 (1983). Because of the random assortment of immunoglobulin heavy and light
chains, these hybridomas (quadromas) produce a potential mixture often different antibody
molecules, of which only one has the correct bispecific structure. The purification
of the correct molecule, which is usually done by affinity chromaiography steps, is
rather cumbersome, and the product yields are low. Similar procedures are disclosed
in WO 93/08829, published 13 May 1993, and in Traunecker
et al.,
EMBO J.,
10:3655-3659 (1991).
[0191] According to a different and more preferred approach, antibody variable domains with
the desired binding specificities (antibody-antigen combining sites) are fused to
immunoglobulin constant domain sequences. The fusion preferably is with an immunoglobulin
heavy-chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions.
It is preferred to have the first heavy- chain constant region (CH1) containing the
site necessary for light-chain binding present in at least one of the fusions. DNAs
encoding the immunoglobulin heavy-chain fusions and, if desired, the immunoglobulin
light chain, are inserted into separate expression vectors, and are co-transfected
into a suitable host organism. This provides for great flexibility in adjusting the
mutual proportions of the three polypeptide fragments in embodiments when unequal
ratios of the three polypeptide chains used in the construction provide the optimum
yields. It is, however, possible to insert the coding sequences for two or all three
polypeptide chains in one expression vector when the expression of at least two polypeptide
chains in equal ratios results in high yields or when the ratios are of no particular
significance. In a preferred embodiment of this approach, the bispecific antibodies
are composed of a hybrid immunoglobulin heavy chain with a first binding specificity
in one arm, and a hybrid immunoglobulin heavy-chain/light-chain pair (providing a
second binding specificity) in the other arm. It was found that this asymmetric structure
facilitates the separation of the desired bispecific compound from unwanted immunoglobulin
chain combinations, as the presence of an immunoglobulin light chain in only one half
of the bispecific molecule provides for a facile way of separation. This approach
is disclosed in WO 94/04690 published 3 March 1994. For further details of generating
bispecific antibodies see, for example, Suresh
et al.,
Methods in Enzymology, 121:210 (1986).
E. Heteroconjugate Antibodies
[0192] Heteroconjugate antibodies are also within the scope of the present invention. Heteroconjugate
antibodies are composed of two covalently joined antibodies. Such antibodies have,
for example, been proposed to target immune system cells to unwanted cells (US Patent
No. 4,676,980), and for treatment of HIV infection. WO 91/00360; WO 92/200373; EP
03089. Heteroconjugate antibodies may be made using any convenient cross-linking methods.
Suitable cross-linking agents are well known in the art, and are disclosed, for example,
in U.S. Pat. No. 4,676,980, along with a number of cross-linking techniques.
5. Uses of VRP Antibodies
i. Therapeutic Uses
[0193] VRP antibodies may be useful in certain therapeutic indications to block activity
of the VRP (for example, to block excess activation or inhibition of the Flt4 receptor
or another receptor that binds to VRP, and to block neovascularization, re-endothelialization,
and angiogenesis). Specifically, the VRP antibodies are useful in the treatment of
various neoplastic and non-neoplastic diseases and disorders. Neoplasms and related
conditions that are amenable to treatment include breast carcinomas, lung carcinomas,
gastric carcinomas, esophageal carcinomas, colorectal carcinomas, liver carcinomas,
ovarian carcinomas, thecomas, arrhenoblastomas, cervical carcinomas, endometrial carcinoma,
endometrial hyperplasia, endometriosis, fibrosarcomas, choriocarcinoma, head and neck
cancer, nasopharyngeal carcinoma, laryngeal carcinomas, hepatoblastoma, Kaposi's sarcoma,
melanoma, skin carcinomas, hemangioma, cavernous hemangioma, hemangioblastoma, pancreas
carcinomas, retinoblastoma, astrocytoma, glioblastoma, Schwannoma, oligodendroglioma,
medulloblastoma, neuroblastomas, rhabdomyosarcoma, osteogenic sarcoma, leiomyosarcomas,
urinary tract carcinomas, thyroid carcinomas. Wilm's tumor, renal cell carcinoma,
prostate carcinoma, abnormal vascular proliferation associated with phakomatoses,
edema (such as that associated with brain tumors), and Meigs' syndrome.
[0194] Non-neoplastic conditions that are amenable to treatment include rheumatoid arthritis,
psoriasis, atherosclerosis, diabetic and other retinopathies, retrolental fibroplasia,
neovascular glaucoma, age-related macular degeneration, thyroid hyperplasias (including
Grave's disease), comeal and other tissue transplantation, chronic inflammation, lung
inflammation, nephrotic syndrome, preeclampsia, ascites, pericardial effusion (such
as that associated with pericarditis), and pleural effusion.
[0195] Age-related macular degeneration (AMD) is a leading cause of severe visual loss in
the elderly population. The exudative form of AMD is characterized by choroidal neovascularization
and retinal pigment epithelial cell detachment Because choroidal neovascularization
is associated with a dramatic worsening in prognosis, the VRP antibodies of the present
invention are expected to be especially useful in reducing the severity of AMD.
[0196] For therapeutic applications, the VRP antibodies of the invention are administered
to a mammal, preferably a human, in a pharmaceutically acceptable dosage form, including
those that may be administered to a human intravenously as a bolus or by continuous
infusion over a period of time, by intramuscular, intraperitoneal, intra-cerobrospinal,
subcutaneous, intra-articular, intrasynovial, intrathecal, oral, topical, or inhalation
routes. The VRP antibodies also are suitably administered by intratumoral, peritumoral,
intralesional, or perilesional routes or to the lymph, to exert local as well as systemic
therapeutic effects. The intraperitoneal route is expected to be particularly useful,
for example, in the treatment of ovarian tumors.
[0197] Such dosage forms encompass pharmaceutically acceptable carriers that are inherently
non-toxic and non-therapeutic. Examples of such carriers include ion exchangers, alumina,
aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances
such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures
of saturated vegetable fatty acids, water, salts, or electrolytes such as protamine
sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride,
zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based
substances, and PEG. Carriers for topical or gel-based forms of VRP antibodies include
polysaccharides such as sodium carboxymethylcellulose or methylcellulose, polyvinylpyrrolidone,
polyacrylates, polyoxyethylene-polyoxypropylene-block polymers, PEG, and wood wax
alcohols. For all administrations, conventional depot forms are suitably used. Such
forms include, for example, microcapsules, nano-capsules, liposomes, plasters, inhalation
forms, nose sprays, sublingual tablets, and sustained-release preparations. The VRP
antibody will typically be formulated in such vehicles at a eoncentration of about
0.1 mg/ml to 100 mg/ml.
[0198] Suitable examples of sustained-release preparations include semipermeable matrices
of solid hydrophobic polymers containing the VRP antibody, which matrices are in the
form of shaped articles, e.g. films, or microcapsules. Examples of sustained-release
matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate)
as described by Langer
et al., supra and Langer,
supra, or poly(vinylalcohol), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic
acid and gamma ethyl-L-glutamate (Sidman
et al.,
supra), non-degradable ethylene-vinyl acetate (Langer
et al., supra), degradable lactic acid-glycolic acid copolymers such as the Lupron Depot™ (injectable
micropheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate),
and poly-D-(-)-3-hydroxybutyric acid. While polymers such as ethylene-vinyl acetate
and lactic acid-glycolic acid enable release of molecules for over 100 days, certain
hydrogels release proteins for shorter time periods. When encapsulated VRP antibodies
remain in the body for a long time. they may denature or aggregate as a result of
exposure to moisture at 37°C, resulting in a loss of biological activity and possible
changes in immunogenicity. Rational strategies can be devised for stabilization depending
on the mechanism involved. For example, if the aggregation mechanism is discovered
to be intermolecular S-S bond formation through thio-disulfide interchange, stabilization
may be achieved by modifying sulfhydryl residues, lyophilizing from acidic solutions,
controlling moisture content, using appropriate additives, and developing specific
polymer matrix compositions.
[0199] Sustained-release VRP antibody compositions also include liposomally entrapped antibodies.
Liposomes containing the VRP antibodies are prepared by methods known in the art,
such as described in Epstein
et al.,
Proc. Natl. Acad. Sci. USA,
82:3688 (1985); Hwang
et al., Proc. Natl. Acad. Sci. USA, 77:4030 (1980); and U.S. Pat. Nos. 4,485,045 and 4,544,545. ordinarily, the liposomes
are the small (about 200-800 Angstroms) unilamelar type in which the lipid content
is greater than about 30 mol.% cholesterol, the selected proportion being adjusted
for the optimal VRP antibody therapy. Liposomes with enhanced circulation time are
disclosed in U.S. Patent No. 5,013,556.
[0200] Another use of the present invention comprises incorporating VRP antibodies into
formed articles. Such articles can be used in modulating endothelial cell growth and
angiogenesis. In addition, tumor invasion and metastasis may be modulated with these
articles.
[0201] For the prevention or treatment of disease, the appropriate dosage of VRP antibody
will depend on the type of disease to be treated, as defined above, the severity and
course of the disease, whether the antibodies are administered for preventive or therapeutic
purposes, previous therapy, the patient's clinical history and response to the VRP
antibody, and the discretion of the attending physician. The VRP antibody is suitably
administered to the patient at one time or over a series of treatments.
[0202] Depending on the type and severity of the disease, about 1 µg/kg to 15 mg/kg of VRP
antibody is an initial candidate dosage for administration to the patient, whether,
for example, by one or more separate administrations, or by continuous infusion. A
typical daily dosage might range from about 1 µg/kg to 100 mg/kg or more, depending
on the factors mentioned above. For repeated administrations over several days or
longer, depending on the condition, the treatment is sustained until a desired suppression
of disease symptoms occurs. However, other dosage regimens may be useful. The progress
of this therapy is easily monitored by conventional techniques and assays, including,
for example, radiographic tumor imaging.
[0203] According to another embodiment of the invention, the effectiveness of the VRP antibody
in preventing or treating disease may be improved by administering the VRP antibody
serially or in combination with another proteinaceous agent that is effective for
those purposes, such as those enumerated below, or one or more conventional therapeutic
agents such as. for example, alkylating agents, folic acid antagonists, anti-metabolites
of nucleic acid metabolism, antibiotics, pyrimidine analogs, 5-fluorouracil, cisplatin,
purine nucleosides, amines, amino acids, triazol nucleosides, or corticosteroids.
Such other agents may be present in the composition being administered or may be administered
separately. Also, the VRP antibody is suitably administered serially or in combination
with radiological treatments, whether involving irradiation or administration of radioactive
substances.
[0204] In one embodiment, vascularization of tumors is attacked in combination therapy.
One or more VRP antibodies are administered to tumor-bearing patients at therapeutically
effective doses as determined, for example, by observing necrosis of the tumor or
hs meiastatic foci, if any. This therapy is continued until such time as no further
beneficial effect is observed or clinical examination shows no trace of the tumor
or any metastatic foci. Then the proteinaceous auxiliary agent is administered, alone
or in combination with another auxiliary agent. Such agents include,
e.g., TNF, an antibody capable of inhibiting or neutralizing the angiogenic activity
of aFOF or bFGF or hepatocyte growth factor (HGF), an rhVEGF antagonist as described
in WO 94/10202,
supra, alpha-, beta-, or gamma-interferon, anti-HER2 antibody, heregulin, anti-heregulin
antibody, D-factor, interleukin-1 (IL-1), interleukin-2 (IL-2), GM-CSF, or agents
that promote microvascular coagulation in tumors, such as anti-protein C antibody,
anti-protein S antibody, or C4b binding protein (WO 91/01753 published 21 February
1991), or heat or radiation.
[0205] Since the auxiliary agents will vary in their effectiveness it is desirable to compare
their impact on the tumor by matrix screening in conventional fashion. The administration
of VRP antibody and TNF and/or other auxiliary agent is repeated until the desired
clinical effect is achieved. Alternatively, the VRP antibody or antibodies are administered
together with TNF and, optionally, other auxiliary agent(s). In instances where solid
tumors are found in the limbs or in other locations susceptible to isolation from
the general circulation, the therapeutic agents described herein are administered
to the isolated tumor or organ. In other embodiments, a FGF or platelet-derived growth
factor (PDGF) antagonist, such as an anti-FGF or an anti-PDGF neutralizing antibody,
is administered to the patient in conjunction with the VRP antibody. Treatment with
VRP antibodies optimally may be suspended during periods of wound healing or desirable
neovascularization.
ii. Other Uses
[0206] The VRP antibodies of the invention also are useful as affinity purification agents.
In this process, the antibodies against VRP are immobilized on a suitable support,
such a Sephadex resin or filter paper, using methods well known in the art. The immobilized
antibody then is contacted with a sample containing the VRP to be purified, and thereafter
the support is washed with a suitable solvent that will remove substantially all the
material in the sample except the VRP, which is bound to the immobilized antibody.
Finally, the support is washed with another suitable solvent, such as glycine buffer,
pH 5.0, that will release the VRP from the antibody.
[0207] VRP antibodies may also be useful in diagnostic assays for VRP,
e.g., detecting its expression in specific cells, tissues, or serum. The antibodies are
labeled in the same fashion as VRP described above and/or are immobilized on an insoluble
matrix. VRP antibodies also are useful for the affinity purification of VRP from recombinant
cell culture or natural sources. VRP antibodies that do not detectably cross-react
with other proteins can be used to purify VRP free from these other known proteins.
Suitable diagnostic assays for VRP and its antibodies are described above.
III. Experimental
[0208] Below are examples of specific embodiments for carrying out the present invention.
The examples are offered for illustrative purposes only, and are not intended to limit
the scope of the present invention in any way.
[0209] All publications, patents and patent applications cited herein, whether
supra or
infra, are hereby incorponted by reference in their entirety.
EXAMPLE 1
Isolation of cDNA Clones Encoding Human Flt4 Receptor
[0210] cDNA synthesized from mRNA purified from the human megakaryocyte leukemia cell line
CMK11-5 was amplified with redundant PCR primers based on the conserved regions of
tyrosine kinase receptors. Wilks,
Proc. Natl. Acad. Sci. USA,
86: 1603-1607(1989). One amplified fragment of about 180 bp with a unique DNA sequence
(designated SAL-S1 or tk1; PCT/US93/00586,
supra) was used to screen (Janssen
et al.,
supra)cDNA libraries from CMK11-5 and DAM1 cells to obtain overlapping clones that encoded
the full-length short form of Flt4 receptor (1298 amino acids). The sequence of the
assembled Flt4-encoding clones matched that reported from an anerythroleukemia cell
line (Pajusola
et al.,
Cancer Res., supra); it encodes 8 amino acid differences from another reported Flt4 sequence. Galland
et al.,
Oncogene,
supra. Clones encoding the long form of Flt4 (1363 amino acids) were constructed by synthesizing
the differing 3' DNA sequence of about 200 bp based on the published sequence. Pajusola
et al.,
Oncogene,
8,
supra.
EXAMPLE 2
Receptor IgG Fusion Proteins, Flt4/IgG Antiserum. and G61 FACS Analysis
[0211] Flt1/IgG (Park
et al., supra), Flk1/IgG (Park
et al.,
supra), Rse/IgG (Godowski
et al.,
Cell,
82: 355-358 [1995]), and Htk/IgG (Bennett
et al.,
J. Biol. Chem.,
269: 14211-14218 [1994]) were produced as described in these references. For Flt4/IgG,
DNA encoding the extracellular domain of the Flt4 receptor (amino acids 1-775) was
spliced to the Fc region of a human IgG heavy chain at the unique
BstEII site in the plasmid pBSSK-Fc (pBSSK-CH2CH3). Bennett
et al.,
J. Biol. Chem.. 266:23060-23067(1991). The open reading frame encoding Flt4/IgG was cloned in the mammalian
expression vector pRK5 (Suva
et al.,
Science, 237:893-896 [1987]) to yield the plasmid pRK5.tk1ig1.1. This plasmid was transfected
by electroporation (Janssen
et al.
, supra) into 293 cells (ATCC CRL 1651), and after 3-4 days, Flt4/IgG was purified from the
serum-free conditioned medium with protein A agarose (Calbiochem). Flt4 antiserum
was generated by injection of purified Flt4/IgG into rabbits.
[0212] By using this fusion protein to screen cell lines for membrane-bound VRP by FACS
analysis, one positive cell line was identified, G61. described below.
[0213] The human glioma cell line, G61 (Hamel
et al.,
J. Neurosci. Res.,
34: 147-157 [1993]), was cultured in F12:DMEM (50:50) (high glucose) containing 10%
fetal bovine serum, 2 mM L-glutamine. and antibiotics. For FACS analysis of Flt4/IgG
binding to G61 cells, 1 million cells were incubated with 70 nM receptor-IgG fusion
protein in phosphate-buffered saline (PBS), 5% goat serum, 2% rabbit strum for 60
min. at 4°C and then stained with 10 µg/mL biotin-SP-conjugated goat anti-human Fc
antibody and 10 µg/mL R-phycoerythrin-conjugated streptavidin (Jackson Immuno Research).
G61 caused about a 10-fold shift in peak fluorescence intensity that was specific
for Flt4/IgG as compared to Rse/JgG, an unrelated tyrosine kinase receptor complex
(Fig. 2). Attempts to expression clone this putative membrane-bound VRP by the transfection
of pools of cDNA clones into COS cells followed by screening with labeled Flt4/IgG
yielded no positives from 640 pools of 1000-5000 clones each.
EXAMPLE 3
Isolation of cDNA Clones Encoding Human VRP
[0214] A cDNA library was prepared from polyA+ RNA isolated as described in Cathala
et al.,
DNA:
2: 329-335 (1983) and Aviv and Leder,
Proc. Natl. Acad. Sci. USA, 69: 1408-1412 (1972) from the human glioma cell line, G61. Hamel
et al.,
supra. cDNA was prepared from this RNA with reagents from GIBCO/BRL (Superscript) and cloned
in the plasmid pRK5B (Holmes
et al.,
Science,
253: 1278-1280 [1991]) digested with
XhoI and
NotI. Clones encoding VRP were isolated by screening the cDNA library with synthetic
oligonucleotide probes based on an EST sequence (GenBank locus HSC1WF111), which showed
a reasonable match to VEGF. The EST sequence of HSC1WF111 is 299 bp and is 36% identical
to VEGF over 50 residues, including an 11 of 13 residue match beginning at VEGF amino
acid 56. The sequence is as follows:

[0215] The soquences of the oligonucleotile probes ovh 1.4 and ovh 1.5 employed are indicated
below.

[0216] These two probes were
32P labeled and hybridized in 20% formamide at 42°C with a final wash in 30 mM NaCl/3
mM trisodium citrate at 55°C. Janssen,
Current Protocols in Molecular Biology, John Wiley & Sons (1995). Seven positives were identified and characterized from
650.000 clones screened. The positives fell into three groups by restriction mapping
and DNA sequencing.
[0217] Clones VH1.4 (pRK.vh1.4.1) and VH1.6 included the full coding region (Fig. 3A) and
were sequenced completely. They differ only in length and the lack of two T's proceeding
the 3' poly A sequence in VH1.6. Clone VH1.2 is collinear with VH1.4. Clones VR1.3,
VH1.5, and VH1.7 are identical and have a 557 bp deletion when compared with VH1.4
(a deletion of bp 519-1075), and clone VH1.1 has a 152 bp deletion when compared with
VH1.4 (a deletion of bp 924-1075). The nucleotide and deduced amino acid sequences
of VH1.4 are shown in Figure 1.
[0218] The sequence contained an open reading frame of 419 amino acids beginning with an
ATG codon preceded by a purine residue at position -3 as expected for a translation
initiation site. Kozak,
Nucl. Acids Res., 12:857-872 (1984). About 250 bp 5' of this ATG are two in-frame ATG codons followed
shortly (4 or 10 amino acids) by a stop codon. Both of these ATG's have a pyrimidine
at position -3 and would not be expected to function as a strong translation initiation
site. Kozak,
supra. The encoded amino acid sequence imediately following the start of the 419 amino
acid reading frame is hydrophobic. indicative of an amino-terminal secretion signal
sequence. Perlman and Halvorson,
J. Mol. Biol.,
167:391.409 (1983). See Figure 3A. The most likely cleavage site for this sequence would
be after amino acid 20, although cleavage following residues 15 or 16 cannot be excluded,
von Heijne,
Nucl. Acids Res., 14: 4683-4690 (1986). The open reading frame is preceded by a GC-rich 5' untranslated
region of about 380 bp and followed by a 3' untranslated region of about 400 bp.
[0219] The predicted mature amino acid sequence of human VRP contains 399 amino acid residues
(translated M
T = 44.8 kDa), of which 37 (9.3%) are cysteine residues; there are three potential
N-linked glycosylation sites (Fig. 3A). An alignment of the amino acid sequence of
VRP with the six forms of VEGF and PIGF shows that it is most similar to VEGF
121 (32% identical) and PIGF
131 (27% identical) (Fig. 3B); the locations of 8 of the 9 cysteinc residues are conserved.
While VRP does not contain the regions of basic amino acids found in some forms of
VEGF and PIGF. it is considerably larger than VEGF and contains a cysteine-rich C-terminal
half of the molecule that is not found in VEGF. This cysteine-rich domain has four
copies of the pattern Cys followed by ten non-Cys residues followed by Cys-X followed
by Cys-X and then by Cys (Fig. 3B), a repeat found more than 50 times in a diptran
Balbiani ring 3 protein. Paulsson
et al.,
J. Mol. Biol.,
211: 331-349 (1990). Without being limited to any one theory, VRP may interact with other
membrane-bound proteins on these cells via the cysteine residues; such an intermolecular
interaction has been proposed for the Balbiani protein. Paulsson
et al.,
supra.
[0220] Two of the cDNA clones (VH1.1 and VH1.3) contained a 152 or 557 bp deletion when
compared with VH1.4 (Fig. 3A). Both these deletions end at the same nucleotide and
are presumed to be the result of alternative splicing. Both deletions would be expected
to encode the same frame-shifted protein 3' of the deletion which terminates at a
stop codon within 15 amino acids. The protein encoded by VH1.3 would include none
of the core cysteine region similar with VEGF. VH1.1 contains much of the region that
is similar to VEGF; its deletion. however, is not analogous to the various known forms
of VEGF or PIGF. Ferrara
et al.,
supra; Maglione
et al.,
supra; Hauser and Weich,
supra.
[0221] Figure 4 discloses an alignment of VH1.4 (top) with 11 EST cDNA sequences from GenBank.
It is noted that the 3' EST's are at the poly A end and that the EST's cover only
a little more than half of the full-length sequence of VH1.4.
EXAMPLE 4
Receptor IgG Precipitation of 35S-Labeled VRP
[0222] To determine whether VRP is a ligand for Flt4, expression plasmids containing the
VH1.4 cDNA clone, as well as control plasmids (the expression vector alone or with
VEGF or PlGF DNA), were transfected into COS7 cells and the proteins labeled with
35S amino acids. Conditioned media from these cells was precipatated with Flt4/IgG and
Flk1/IgG. Specifically, the VRP expression plasmid. pRK.vh1.4.2, was constructed by
deleting about 360 bp of 5' untranslated sequence (5' of the
Agel site (Fig. 3A) from VH1.4). This DNA and control plasmids encoding VEGF
165 (Houck
et al.,
Mol. Endocrinol.,
5: 1806-1814 [1991]), PIGF
152 (Park
et al.,
supra), or the vector alone (pRK5; Suva
et al., supra) were transfected into COS7 cells with DEAE-dextran. Janssen
et al., supra. Two days after transfection, the cells were pulse-labeled in 10-cm dishes for 5 hours
with 5 mL of methionine- and cysteine-free DMEM supplemented with 100 µCi/mL of
35S amino acids (Pro-Mix™ brand: Amersham #SJQ0079) at 37° C. and then chased with DMEM
for 7 hours. The labeled conditioned medium was concentrated 10-fold by spin concentration
(Centricon-10™ brand: Amicon #4203). Fifty µL of the concentrated medium was incubated
with 3 µg of receptor IgG and 80 µL of a 50% slurry of protein A agarose (Calbiochem)
overnight at 4°C. The precipitates were washed with PBS/0.1% Triton X-100. boiled
in SDS sample buffer, and electrophoresed on 12% SDS polyacrylamide gels (Novex #EC60052).
The gels were treated with autoradiography enhancer (duPont #NEF974) and exposed overnight
at -70°C.
[0223] Two specific bands of 53 kDa and 33 kDa were precipitated from the VRP transfection
by the Flt4/IgG; these bands were absent in the vector transfection. Little or no
specific precipitation of these two bands was found with Flt1/IgG or Flk1/IgG. At
times, some VRP precipitation was detected with Flk1/IgG. suggesting that VRP may
have a tow-affinity interaction with Flk1. Transfection with a VEGF-expressing plasmid
showed the expected precipitation of a strong band of about 22 kDa with Flt1/IgG and
Flk1/IgG (DeVries
et al.,
supra; Quinn
et al.,
supra; Millauer
et al.,
supra; Terman
et al.,
Biochem. Biophys. Res. Commum.,
supra), but no precipitation with Flt4/IgG. Similar experiments with labeled PIGF showed
no precipitation by Flt4/IgG, but did give the expected precipitation by Flt1/IgG,
but not by Flk1/IgG. Park
et al.,
supra. These data indicate that the VRP binds to the extracellular domain of the Flt4 receptor,
but does not interact (or does so much more weakly) with the VEGF receptors Flt1 or
Flk1. They also confirm the lack of an interaction of VEGF with Flt4 (Pajusola
et al.,
Oncogene,
9,
supra) and indicate that PIGF is also not a ligand for this receptor.
EXAMPLE 5
Tyrosine Phosphorylation of Flt4 Receptor
[0224] To assay Flt4 tyrosine phosphorylation (also described in PCT/US93/00586,
supra), Flt4 was expressed in 293 cells and Flt4 phosphorylation monitored by phosphotyrosine
immunoblot. Specifically, DNA encoding the long form of human Flt4 was cloned into
the mammalian expression vector pRK5 (Suva
et al.,
supra) to give the plasmid pRK.tk1-3.1. This plasmid was co-transfected with a plasmid
containing a miroglycoside phosphotransferase (neo) transcription unit into 293 cells
by calcium phosphate precipitation (Janssen
et al.,
supra), and stably transfected lines were selected by growth on G418 (Cibco). One clonal
cell line expressing Flt4 (clone 31), as determined by FACS analysis with Flt4/IgG
antiserum, and untransfected 293 cells were used in the Flt4 tyrosine phosphorylation
assays. One million cells in 100 µL of PBS/0.1% bovine serum albumin (BSA) were mixed
with 100 µL of sample and incubated at 37°C for 15 minutes. The cells were then collected
by centrifugation and lysed in 250 µL of 0.15 M NaCl, 10% glycerol. 1% Triton X-100,
50 mM HEPES pH 7.3, 4 µg/mL PMSF, 0.02 u/mL aprotinin (Sigma A6279), and 20 mM sodium
orthovanadate. Flt4 was immunoprecipitated by the addition of 8 µL of rabbit Flt4/IgG
antiserum and 30 µL of protein A agarose. Washed precipitates were boiled in SDS sample
buffer, electrophoresed on polyacrylamide gels (Novex), transferred to nitrocellulose
(Janssen
et al., supra), and probed with an anti-phosphotyrosine monoclonal antibody (Upstate Biotechnology)
and an alkaline phosphatase detection system (Promega).
[0225] Samples containing VRP or VEGF were prepared by the electroporation of expression
plasmids encoding VH1.4 (pRK.vhl.4.2) or VEGF (Houck
et al.,
supra) into 293 cells and 20-fold concentration (Centricon-10, Amicon) of the 3-day scrum-free
conditioned medium. In the receptor IgG competition experiments, the concentrated
conditioned media were pre-incubated 1 hour at 4°C with receptor IgG.
[0226] Without stimulation. 293 cells expressing or not expressing Flt4 showed little or
no Flt4 tyrosine phosphorylation. Stimulation of the Flt4-expressing cells by Flt4/IgG
antiserum showed the tyrosine phosphorylation of two bands of 180 and 120 kDa. No
increase above basal phosphorylation was observed with preimmune serum, and no bands
were found with Flt4/IgG antiserum stimulation of non-expressing cells. Two Flt4 bands
of about this size have been reported as being expressed by DAM1 and HEL cells. Pajusola
et al.,
Oncogene,
8,
supra. In addition. SDS gel analysis of purified Flt4/IgG shows that it is composed of
peptides of 150, 80, and 70 kDa. N-terminal amino acid sequence of the Flt4/IG peptides
shows that the 150 and 70 kDa bands have the amino acid sequence YSMTPPTL (SEQ ID
NO: 9) (matching the Flt4 sequence starting at residue 25) and that the 80 kDa band
has the sequence SLRRRQQQD (SEQ ID NO: 10) (matching the Flt4 sequence beginning at
residue 473). Thus, both the Flt4/IgG and full-length Flt4 appear to be partially
cleaved in the extracellular domain, and the tyrosine phosphorylated bands of 180
and 120 kDa observed in the Flt4 phosphorylation assays would correspond to the 150
and 80 kDa peptides of Flt4/IgG. Addition of a polyclonal antiserum to the Flt4 expressing
cells showed the tyrosine phosphorylation of two Flt4 bands of 180 and 120 kDa; no
bands were observed in non-expressing cells. These data show that polyclonal antibodies
generated to the extracellular domain of the Flt4 receptor are capable of activating
Flt4 tyrosine phosphorylation.
[0227] To determine whether VRP could activate the tyrosine phosphorylation of Flt4. conditioned
media from mammalian cells transfected with the VRP expression plasmid was assayed.
This conditioned medium stimulated the tyrosine phosphorylation of the same 180 and
120 kDa bands found with the agonist polyclonal antibodies, demonstrating that VRP
is able to stimulate the phosphorylation of, as well as bind to, Flt4. Conditioned
medium from VEGF-expressing cells failed to activate Flt4 tyrosine phosphorylation.
[0228] To confirm the specificity of VRP binding to the receptors of the VEGF family, Flt4/IgG,
Flt1/IgG, Flk1/IgG, and Htk/IgG were tested for their ability to compete for VRP-stimulated
Flt4 phosphorylation. As expected if VRP is a ligand for Flt4. Flt4/IgG prevented
the VRP-stimulated phosphorylation, while Flt1/IgG, Flk1/IgG, and Htk/IgG, a fusion
protein from an unrelated tyrosine kinase receptor, had little or no effect. These
data show that VRP is able to induce the tyrosine phosphorylation of Flt4.
EXAMPLE 6
Purification of VRP and Binding to Labeled Flt4/IgG
[0229] The reading frame encoding the N-terminal secretion signal sequence and about 30
amino acids of the herpes glycoprotein D (Lasky and Dowbenko,
DNA. 3:23-29 [1984]: Pennica
et al.,
Proc. Natl. Acad. Sci. USA. 92: 1142-1146 [1995]) were fused with a short linker sequence to the putative mature
sequence of VRP. Following secretion from mammalian cells, this construct is expected
to give the N-terminal glycoprotein D sequence:
KYALADASLKMADPNRFRGKDLPVLDQLLEGGAAHYALLP (SEQ ID NO: 11) followed by the mature VRP
sequence GPREAPAAAAAFE (SEQ ID NO: 12). DNA encoding this fusion protein was cloned
into the vector pRK5 to give the plasmid pRK. vh 1.4.5. This plasmid was transfected
into 293 cells by electroporation (Janssen et al., supra), and VRP purified from the 3-4 day serum-free conditioned medium by monoclonal antibody
(5B6) affinity chromatography and quantitated by colorimctric assay (Bio-Rad). This
antibody is specific for the glycoprotein D sequence fused to the N-terminus of VRP.
[0230] Flt4/IgG was iodinated to a specific activity of 1000-1500 Ci/mmol with lodobeads™
brand iodinated beads (Pierce). Binding was performed with ∼20,000 cpm
125I-Flt4/IgG and 12 ng VH1.4 gD fusion protein in PBS. 0.5% BSA, 0.02% Tween-20™ surfactant,
1 µg/mL heparin (binding buffer) containing 20 µL of a 50% slurry of glass beads conjugated
to ∼30 µg anti-gD monoclonal antibody (5B6) in a final volume of 100 µL for 4-6 hours
at 22°C. Beads were collected by filtration (Millipore Multiscreen-HV), washed five
times with 200 µL binding buffer, and counted. For binding at increasing concentrations
of Flt4/IgG (Fig. 5B) the binding buffer was DMEM (low glucose):F12 (50:50), 20 mM
sodium HEPES, pH 7.2, 10% fetal bovine serum, 0.2% gelatin, and 1 µg/mL heparin.
[0231] The purified VRP specifically bound to
125I-Flt4/IgG, and the binding was not competed by unlabeled Flt1/IgG or Flk1/IgG (Fig.
5A). Binding competition with increasing concentrations of unlabeled Flt4/IgG (Fig.
5B) gave an EC
50 for this interaction of ∼0.7 nM, suggesting that the binding of VRP to Flt4 is of
high affinity as would be expected if VRP is a biologically relevant ligand for Flt4.
RNA Blots
[0232] Blots containing poly(A)
+ human RNA were from Clontech. For the G61 glioma cell line, 5 µg of poly(A)
+ and poly(A)- RNA were electrophoresed on a 1% agarose/2.2 M formaldehyde gel and
transferred to nitrocellulose (Janssen
et al., supra). Blots were hybridized with
32P-labeled probes ovh1.4 and ovh1.5 and washed in 30 mM NaCl/3 mM trisodium citrate
at 55°C.
[0233] The G61 glioma cell line used in the cloning of VRP expresses a major VRP RNA band
of about 2.4 kb. A minor band of about 2.2 kb may also be present. A 2.4 kb band was
expressed in adult human tissues from heart, placenta, ovary, and small intestine:
a weaker band was found in lung, skeletal muscle, spleen, prostrate, testis, and colon.
Expression of a 2.4 kb mRNA was also found in fetal lung and kidney.
EXAMPLE 7
Mitogenic Activity of VRP
[0234] To test whether VRP has mitogenic activity like that found for VEGF, the growth of
human lung endothelial cells was determined at increasing concentrations of VRP or
VEGF (Figure 6). Specifically, human lung microvascular endothelial cells (HMVEC-L,
Clonetics, San Diego, CA) were maintained in the recommended growth medium (EGM-MV
with 5% fetal calf serum). For the assay of mitogenesis, low passage (<6) cells were
seeded at 6500 cells/well in 48-well plates (Costar) and maintained overnightin the
recommended growth medium. The medium was removed, and the cells were maintained in
the growth medium (2% fetal calf serum) without bovine brain extract and supplemented
with VEGF or VRP. After four days. the cells were removed with trypsin and counted
with a Coulter counter (Hialeah, FL).
[0235] VRP promoted the growth of these endothelial cells (see Fig. 6), and thus shares
this mitogenic activity with VEGF. This is in contrast to PIGF, which has been reported
to lack such mitogenic activity (at ≤ 35 nM). Park
et al.,
supra. While an effective mitogenic agent, VRP was about 100 fold less potent than VEGF
in this assay.
[0236] In conclusion, a novel secreted protein. VRP. has now been identified that is a Flt4
ligand and that stimulates the tyrosine phosphorylation of the receptor tyrosine kinase
Flt4. VRP is a third member of the VEGF protein family and has about 30% amino acid
identity with VEGF and PIGF. In addition to the VEGF-like domain, VRP contains a ~180
amino acid C-terminal, cysteine-rich domain not found in other members of the VEGF
family. VRP fails to interact appreciably with the VEGF receptors Flt1 and Flk1.
Deposit of Material
[0237] The following plasmid has been deposited with the American Type Culture Collection.
12301 Parklawn Drive, Rockville, MD, USA (ATCC):
| Plasmid |
ATCC Dep. No. |
Deposit Date |
| pRK.vh1.4.1 |
97249 |
September 6, 1995 |
[0238] This deposit was made under the provisions of the Budapest Treaty on the International
Recognition of die Deposit of Microorganisms for the Purpose of Patent Procedure and
the Regulations thereunder (Budapest Treaty). This assures maintenance of a viable
culture of the deposit for 30 years from the date of deposit. The deposit will be
made available by ATCC under the terms of the Budapest Treaty, and subject to an agreement
between Genentech. Inc. and ATCC, which assures permanent and unrestricted availability
of the progeny of the culture of the deposit to the public upon issuance of the pertinent
U.S. patent or upon laying open to the public of any U.S. or foreign patent application,
whichever comes first, and assures availability of the progeny to one determined by
the U.S. Commissioner of Patents and Trademarks to be entitled thereto according to
35 USC §122 and the Commissioner's rules pursuant thereto (including 37 CFR §1.14
with particular reference to 886 OG 638).
[0239] The assignee of the present application has agreed that if a culture of the plasmid
on deposit should die or be lost or destroyed when cultivated under suitable conditions,
the plasmid will be promptly replaced on notification with another of the same plasmid.
Availability of the deposited plasmid is not to be construed as a license to practice
the invention in contravention of the rights granted under the authority of any government
in accordance with its patent laws.
[0240] The foregoing written specification is considered to be sufficient to enable one
skilled in the art to practice the invention. The present invention is not to be limited
in scope by the construct deposited, since the deposited embodiment is intended as
a single illustration of certain aspects of the invention and any constructs that
are functionally equivalent are within the scope of this invention. The deposit of
material herein does not constitute an admission that the written description herein
contained is inadequate to enable the practice of any aspect of the invention, including
the best mode thereof. nor is it to be construed as limiting the scope of the claims
to the specific illustrations that it represents. Indeed, various modifications of
the invention in addition to those shown and described herein will become apparent
to those skilled in the art from the foregoing description and fall within the scope
of the appended claims.
SEQUENCE LISTING
[0241]
(1) GENERAL INFORMATION:
(i) APPLICANT: Genentech, Inc.
(ii) TITLE OF INVENTION: VEGF-Related Protein
(iii) NUMBER OF SEQUENCES: 12
(iv) CORRESPONDENCE ADDRESS:
(A) ADDRESSEE: Genentech, Inc.
(B) STREET: 460 Point San Bruno Blvd
(C) CITY; South San Francisco
(D) STATE: California
(E) COUNTRY: USA
(F) ZIP: 94080
(v) COMPUTER READABLE FORM:
(A) MEDIUM TYPE: 3.5 inch, 1.44 Mb floppy disk
(B) COMPUTER: IBM PC compatible
(C) OPERATING SYSTEM: PC-DOS/MS-DOS
(D) SOFTWARE: WinPatin (Genentech)
(vi) CURRENT APPLICATION DATA:
(A) APPLICATION NUMBER:
(B) FILING DATE:
(C) CLASSIFICATION:
(viii) ATTORNEY/AGENT INFORMATION:
(A) NAME: Lee, Wendy M.
(B) REGISTRATION NUMBER: P-40,378
(C) REFERENCE/DOCKET NUMBER: P0963PCT
(ix) TELECOMMUNICATION INFORMATION:
(A) TELEPHONE: 415/225-1994
(B) TELEFAX: 415/952-9881
(C) TELEX; 910/371-7168
(2) INFORMATION FOR SEQ ID NO:1:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 2031 base pairs
(B) TYPE: Nucleic Acid
(C) STRANDEDNESS: Single
(D) TOPOLOGY: Linear
(xi) SEQUENCE DESCRIPTION: SEQ ID NO:1:



(2) INFORMATION FOR SEQ ID NO:2:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 2031 base pairs
(B) TYPE: Nucleic Acid
(C) STRANDEDNESS: Single
(D) TOPOLOGY: Linear
(xi) SEQUENCE DESCRIPTION: SEQ ID NO:2:


(2) INFORMATION FOR SEQ ID NO:3:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 419 amino acids
(B) TYPE: Amino Acid
(D) TOPOLOGY: Linear
(Xi) SEQUENCE DESCRIPTION: SEQ ID No:3:


(2) INFORMATION FOR SEQ ID NO:4:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 147 amino acids
(B) TYPE: Amino Acid
(D) TOPOLOGY: Linear
(xi) SEQUENCE DESCRIPTION: SEQ ID NO:4:


(2) INFORMATION FOR SEQ ID NO:5:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 149 amino acids
(B) TYPE: Amino Acid
(D) TOPOLOGY: Linear
(xi) SEQUENCE DESCRIPTION: SEQ ID NO:5:

(2) INFORMATION FOR SEQ ID NO:6:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 299 base pairs
(B) TYPE: Nucleic Acid
(C) STRANDEDNESS: Single
(D) TOPOLOGY: Linear
(xi) SEQUENCE DESCRIPTION: SEQ ID NO:6:


(2) INFORMATION FOR SEQ ID NO:7:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 50 base pairs
(B) TYPE: Nucleic Acid
(C) STRANDEDNESS: Single
(D) TOPOLOGY: Linear
(xi) SEQUENCE DESCRIPTION: SEQ ID NO:7:

(2) INFORMATION FOR SEQ ID NO:8:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 50 base pairs
(B) TYPE: Nucleic Acid
(C) STRANDEDNESS: Single
(D) TOPOLOGY: Linear
(xi) SEQUENCE DESCRIPTION: SEQ ID NO:8:

(2) INFORMATION FOR SEQ ID NO:9:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 8 amino acids
(B) TYPE: Amino Acid
(D) TOPOLOGY: Linear
(xi) SEQUENCE DESCRIPTION: SEQ ID NO:9:

(2) INFORMATION FOR SEQ ID NO:10:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 9 amino acids
(B) TYPE: Amino Acid
(D) TOPOLOGY: Linear
(xi) SEQUENCE DESCRIPTION: SEQ ID NO:10:


(2) INFORMATION FOR SEQ ID NO:11:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 40 amino acids
(B) TYPE: Amino Acid
(D) TOPOLOGY: Linear
(xi) SEQUENCE DESCRIPTION: SEQ ID NO:11:

(2) INFORMATION FOR SEQ ID NO:12:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 13 amino acids
(B) TYPE: Amino Acid
(D) TOPOLOGY: Linear
(xi) SEQUENCE DESCRIPTION: SEQ ID NO:12:
