Field of the Invention
[0001] This invention relates generally to vaccines, and in particular to nucleic acid vaccines.
Background of the Invention
[0002] Papilloma viruses are non-enveloped DNA viruses with a double stranded circular genome
of approximately 9,000 base pairs. Over 75 types of HPV have been typed at the DNA
level, and these can be broadly grouped into families on the basis of their tissue
tropism.
[0003] Histologic, molecular, and epidemiologic evidence have implicated some HPV strains
in cervical dysplasia and cervical cancer. Many studies support the view that most
moderate and severe cervical intraepithelial neoplasias (CIN) contain HPV DNA which
is exclusively detected in the histologically abnormal epithelium of these lesions.
Persistent infection with HPV is believed to be the predominant risk factor for development
of cervical carcinoma. HPV DNA is readily found in episomal form within cells exhibiting
a cytopathic effect, while the HPV DNA is found integrated within the chromosomes
of cells associated with most high grade precancerous lesions and cancer. Approximately
23 HPV types are commonly found in anogenital screening programs, but only 10-15 are
associated with progressive disease. Types 16 and 18 are commonly found in association
with cervical dysplasia and cervical cancer.
[0004] Papilloma viruses contain nine open reading frames. HPV genes with transforming properties
have been mapped to open reading frames E6 and E7. Substantial biochemical work has
demonstrated that the HPV E6 protein inactivates the protein p53, whereas the E7 protein
interferes with retinoblastoma (Rb) protein function. Since p53 and Rb are tumor-suppressor
proteins that function as cell division inhibitors, their inactivation by E6 and E7
leads the cell to enter into S phase of the cell cycle. Expression of E6 and E7 is
sufficient to immortalize some primary cell lines, and blocking E6 or E7 function
has been shown to reverse the transformed state.
[0005] Boursnell
et al. reports a recombinant virus vector encoding part or all of the HPV 16 E6, E7 and
HPV 18 E6, E7 proteins (
US 5719054, column 3, lines 2-35).
Summary of the Invention
[0006] The invention is based in part on the discovery that polypeptide segments, each of
which contains one or more antibody-binding or class I or class II MHC-binding epitopes,
can be linked in tandem to form polyepitope polypeptides which are proteolytically
processed in cells to release the epitopes. These hybrid polypeptides are useful for
stimulating an immune response, particularly when expressed from a nucleic acid within
an antigen-presenting cell (APC).
[0007] The invention features a nucleic acid encoding a hybrid polypeptide the sequence
of which comprises a signal sequence and
- (i) the following segments of human papilloma virus (HPV) strain 16 E6:
AMFQDPQERPRKLPQLCTEL (SEQ ID NO:64),
LLRREVYDFAFRDLCIVYRDGNPY (SEQ ID NO:65), and
KISEYRHYCYSLYGTTLEQQYNK (SEQ ID NO:66);
- (ii) the following segments of HPV strain 16 E7:
TLHEYMLDLQPETTDLYSY (SEQ ID NO:67),
QAEPDRAHYNTVTF (SEQ ID NO:68), and
LLMGTLGIVCPICSQKP (SEQ ID NO:69);
- (iii) the following segments of HPV strain 18 E6:
RRPYKLPDLCTELNTSLQDIETTCVYCKTVLELTEVFEFAFK (SEQ ID NO:152), and
SVYGDTLEKLTNTGLYNLLIRCLRCQK (SEQ ID NO: 153), and
- (iv) the following segments of HPV strain 18 E7:
KATLQDIVLHLEPQNEIPV (SEQ ID NO:154),
HTMLCMCCKCEARI (SEQ ID NO:155), and
AFQQLFLNTLSFVCPWC (SEQ ID NO:156), provided that the hybrid polypeptide does not comprise
a sequence identical to the sequence of either full length, intact E6 or full length,
intact E7 protein from HPV strain 16 or 18.
[0008] As used herein, a "segment" is an amino acid sequence which (a) corresponds to the
sequence of a portion (i.e., fragment less than all) of a naturally occurring protein,
and (b) contains one or more epitopes. For clarity, the term "segment" is used herein
to denote a part of the hybrid polypeptide, while the term "portion" is used to denote
the corresponding part of the naturally occurring protein. By "epitope" is meant a
peptide which binds to the binding groove of an MHC class I or class II molecule or
to the antigen-binding region of an antibody. A methionine codon is preferably included
at the 5' end of this or Any other coding sequence of the invention, to facilitate
translation. In addition, the hybrid polypeptide encodes a targeting signal, as described
in more detail below.
[0009] The relationship between segments and epitopes in the hybrid polypeptides is shown
schematically in Fig. 1. The illustrated hybrid polypeptide is composed of segments
1,2,3, and 4, each of which separately corresponds to a portion of a naturally occurring
protein. Segment 1 can be proteolytically processed within a cell to generate epitopes
a, b, and c. Similarly, segment 2 can be proteolytically processed to generate epitopes
d, e, and f; segment 3 can be processed to generate epitopes g, h, i,j, and k; and
segment 4, upon processing, yields epitopes 1, m, n and o. Adjacent segments can be
contiguous, or can be separated by a spacer amino acid or spacer peptide.
[0010] The polypeptide may optionally include additional segments, e.g., it can include
at least 4, 5, 10, 15, 20, 25, 30, 40, 50, 60, 75, 90, or even 100 or more segments,
each being a portion of a naturally-occurring protein of a pathogenic agent and/or
of a naturally occurring tumor antigen which can be the same or different from the
protein(s) from which the other segments are derived. Each of these segments can be
at least 11 amino acids in length, and each contains at least one epitope (preferably
two or more) different from the epitopes of the other segments. At least one preferably
at least two or three) of the segments in the hybrid polypeptide may contain, e.g.,
3, 4, 5, 6, 7, or even 10 or more epitopes, particularly class I or class II. MHC-binding
epitopes. Two, three, or more of the segments can be contiguous in the hybrid polypeptide:
i.e., they are joined end-to-end, with no spacer between them. Alternatively, any
two adjacent segments can be linked by a spacer amino acid or spacer peptide.
[0011] When the hybrid polypeptide is introduced into a cell, it is proteolytically processed
into at least some of its constituent epitopes. At least some of the epitopes generated
from the segments in the polypeptide can bind to MHC class I or MHC class II molecules
present in the cell, though some of the epitopes may be specific for MHC class I or
class II molecules present only on other cells. The epitopes may alternatively be
B cell epitopes which elicit antibody-mediated immune responses upon binding to antibody
receptors on the surface of a B cell.
[0012] A given segment within the hybrid polypeptide need not be any specified length, so
long as it is sufficiently long to generate at least one epitope, e.g., 2, 3, 4, 5,
or more epitopes, and is at least 11 amino acids in length. For example, a given segment
can have a length of at least 12 amino acids, e.g., at least 13, 14, 15, 20, 25, 30,
40, or 50 amino acids. A given segment corresponds to a particular naturally occurring
protein if any 11 (or more) consecutive amino acids of the segment are found in exactly
the same order in a portion of the naturally occurring protein. The segment is preferably
less than 100 amino acids (less than 95 amino acids for the HPV strain 16 E7 protein)
and more preferably less than 70 or less than 50 amino acids (e.g., 20-50). In one
embodiment, it is less than 15. The segments within the polyepitope polypeptide can
be arranged in any order within the polypeptide. The hybrid polypeptide preferably
does not contain a sequence identical to the sequence of either full length, intact
E6 or full length, intact E7 protein from HPV strain 16 or 18. The sequences of these
proteins can be found at the web sites (ftp://ftp-t10.lanl.gov/pub/papilloma/SWISS-PROT-files/Human-papilloma/HPV
16.swp) and (ftp://ftp-t10.lanl.gov/pub/papilloma/SWISS-PROT-files/Human-papilloma/HPV
18.swp) as viewed on December 7, 1999.
[0013] The additional segments can be derived from any tumor antigen or naturally occurring
antigenic protein of a pathogenic agent. As used herein, "pathogenic agent" means
a virus or microorganism that causes disease in a mammal. By "tumor antigen" is meant
a protein or epitope which is expressed or in a tumor cell but not, or to a lesser
degree, on a cell which is the non-tumor homolog of the tumor cell. Such tumor antigens
frequently serve as markers for differentiating tumor cells from their normal counterparts.
Examples of tumor antigens are listed in Table 1, such as a protein encoded by the
Her2/neu gene, the prostate specific antigen gene, the melanoma antigen recognized
by T cells (MART) gene, or the melanoma antigen gene (MAGE). Examples of proteins
from pathogenic agents include proteins naturally expressed from the genome of a virus,
e.g., a virus which chronically infects cells, such as human papillomavirus (HPV),
human.immunodeficiency virus (HIV), herpes simplex virus (HSV), hepatitis B virus
(HBV), or hepatitis C virus (HCV); a bacterium, such as mycobacteria,
Helicobacter spp. e.g.,
Helicobacter pylori, or
Chlamydia spp.; a fungus; or a parasitic eukaryote, such as
Plasmodium species.
[0014] A representative list of class 1-binding epitopes of appropriate proteins, any of
which could be included in the polyepitope polypeptides of the invention, is included
in Table 2.
[0015] The hybrid polypeptide can contain a first epitope from an HPV protein and a second
epitope that does not overlap with the first epitope and is from the same or a different
HPV protein. ("Different HPV protein" can include a non-identical homolog of the first
protein, derived from a different HPV strain than that from which the first protein
was derived.) The first epitope binds to a first major histocompatibility complex
(MHC) class I allotype and the second epitope binds to a second MHC class I allotype
different from the first MHC class I allotype.
[0016] Because the hybrid polypeptide is made up of protein fragments from different proteins,
or from non-contiguous fragments of a single protein, optionally linked by spacer
amino acids or spacer sequences and optionally joined to a methionine residue or a
targeting signal (see below), the sequence of this hybrid polypeptide is not identical
to the amino acid sequence of either a naturally occurring protein or a fragment of
a naturally occurring protein. Epitopes are included from, the HPV E6 or E7 protein
from HPV strain 16 or 18, other HPV strains are 31, 33, 43, or 45. Thugs, the hybrid
polypeptide includes, segments from each of the HPV strain 16 E6 and E7 proteins,
and segments from each of the HPV strain 18 E6 and E7 proteins. The hybrid polypeptide
is at least 236 amino acids in length, and can be; e.g., at least 250, or 300 amino
acids.
[0017] The MHC class I allotypes to which the epitopes in the hybrid polypeptide bind can
be any human class I allotypes, e.g., HLA-A1, HLA-A2, HLA-A3, HLA-A11, and/or HLA-A24.
A given epitope may be promiscuous, i.e., bind more than one allotype.
[0018] The hybrid polypeptide may also include a third epitope of an HPV protein. This epitope,
which can be derived from the same or a different HPV protein as the first and/or
second epitope, binds to a third MHC class I allotype different from the first and
second MHC class I allotypes. It may, of course, also bind to the first and/or second
MHC class I allotype, in addition to the third. The hybrid polypeptide may include,
e.g., at least 4, 5,6,7,8,9,10,15,25,35,40,50,60,80, or even 100 or more MHC class
I allotype-binding epitopes from one or more HPV proteins. Some of these epitopes
may overlap.
TABLE 1: Tumor Antigens
Cancer |
Associated Antigen |
Melanoma |
BAGE 2-10 |
Breast/Ovarian |
c-ERB2 (Her2/neu) |
Burkitt's lymphoma/Hodgkin's lymphoma |
EBNA-1 |
Burkitt's lymphoma/Hodgkin's lymphoma |
EBNA-2 |
Burkitt's lymphoma/Hodgkin's lymphoma |
EBNA-3 |
Burkitt's lymphoma/Hodgkin's lymphoma |
EBNA-3A |
Burkitt's lymphoma/Hodgkin's lymphoma |
EBNA-3C |
Burkitt's lymphoma/Hodgkin's lymphoma |
EBNA-4 |
Burkitt's lymphoma/Hodgkin's lymphoma |
EBNA-6 |
Burkitt's lymphoma/Hodgkin's lymphoma |
EBV |
Burkitt's lymphoma/Hodgkin's lymphoma |
EBV LMP2A |
Melanoma |
GAGE-1 |
Melanoma |
gp75 |
Cervical |
HPV 16 E6 |
Cervical |
HPV 16 E7 |
Cervical |
HPV 18 E6 |
Cervical |
HPV 18 E7 |
Melanoma |
MAG |
Melanoma |
MAGE-1 |
Melanoma |
MAGE-2 |
Melanoma |
MAGE-3 |
Melanoma |
MAGE-4b |
Melanoma |
MAGE-5 |
Melanoma |
MAGE-6 |
Melanoma |
MART-1/Melan-A |
Pancreatic/Breast/Ovarian |
MUC-1 |
Melanoma |
MUM-1-B |
Breast/Colorectal/Burkitt's lymphoma |
p53 |
Melanoma |
Pmel 17(gp100) |
Prostate |
PSA (Prostate Specific |
Antigen) |
|
Melanoma |
Tyrosinase |
multiple |
CEA (Carcinoembryonic |
Antigen) |
|
lung |
LRP (Lung Resistance Protein) |
multiple |
Bcl-2 |
|
Ki-67 |
TABLE 2: Class I-associated Tumor and Pathogen Epitopes
Peptide |
SEQ ID NO: |
Source Protein |
AARAVFLAL |
1 |
BAGE 2-10 |
YRPRPRRY |
2 |
GAGE-19-16 |
EADPTGHSY |
3 |
MAGE-1 161-169 |
SAYGEPRKL |
4 |
MAGE-1 230-238 |
EVDPIGHLY |
5 |
MAGE-3 161-169 |
FLWGPRALV |
6 |
MAGE-3 271-279 |
GIGILTV |
7 |
MART-1 29-35 |
ILTVILGV |
8 |
MART-1 32-39 |
STAPPAHGV |
9 |
MUC-1 9-17 |
EEKLIVVLF |
10 |
MUM-1 261-269 |
MLLAVLYCL |
11 |
TYROSINASE 1-9 |
SEIWRDIDF |
12 |
TYROSINASE 192-200 |
AFLPWHRLF |
13 |
TYROSINASE 206-214 |
YMNGTMSQV |
14 |
TYROSINASE 369-376 |
KTWGQYWQV |
15 |
PMEL 17 (GP100) 154-162 |
ITDQVPFSV |
16 |
PMEL 17 (GP100) 209-217 |
YLEPGPTVA |
17 |
PMEL 17(GP100) 280-288 |
LLDGTATLRL |
18 |
PMEL 17 (GP100) 476-485 |
ELNEALELEK |
19 |
p53 343-351 |
STPPPGTRV |
20 |
p53 149-157 |
LLPENNVLSPL |
21 |
p53 25-35 |
LLGRNSFEV |
22 |
p53 264-272 |
RMPEAAPPV |
23 |
p53 65-73 |
KIFGSLAFL |
24 |
HER-2/neu 369-377 |
IISAVVGlL |
25 |
HER-2/neu 654-662 |
CLTSTVQLV |
26 |
HER-2/neu 789-797 |
YLEDVRLV |
27 |
HER-2/neu 835-842 |
VLVKSPNHV |
28 |
HER-2/neu 851-859 |
RFRELVSEFSRM |
29 |
HER-2/neu 968-979 |
LLRLSEPAEL |
30 |
PSA 119-128 |
DLPTQEPAL |
31 |
PSA 136-144 |
KLQCVD |
32 |
PSA 166-171 |
VLVASRGRAV |
33 |
PSA 36-45 |
VLVHPQWVL |
34 |
PSA 49-57 |
DMSLLKNRFL |
35 |
PSA 98-107 |
QWNSTAFHQ |
36 |
HBV envelope 121-130 |
VLQAGFF |
37 |
HBV envelope 177-184 |
LLLCLIFL |
38 |
HBV envelope 250-257 |
LLDYQGML |
39 |
HBV envelope 260-267 |
LLVPFV |
40 |
HBV envelope 338-343 |
SILSPFMPLL |
41 |
HBV envelope 370-379 |
PLLPIFFCL |
42 |
HBV envelope 377-385 |
ILSTLPETTV |
43 |
HBV core 529-538 |
FLPSDFFPSV |
44 |
HBV core 47-56 |
KLHLYSHPI |
45 |
HBV polymerase 489-498 |
ALMPLYACI |
46 |
HBVpolymerase 642-651 |
HLYSHPIIL |
47 |
HBV polym. 1076-1084 |
FLLSLGIHL |
48 |
HBV polym. 1147-1153 |
HLLVGSSGL |
49 |
HBV polymerase 43.51 |
GLSRYVARL |
50 |
HBV polymerase 455-463 |
LLAQFTSAI |
51 |
HBV polymerase 527-535 |
YMDDVVLGA |
52 |
HBV polymerase 551-559 |
GLYSSTVPV |
53 |
HBV polymerase 61-69 |
NLSWL |
54 |
HBV polymerase 996-1000 |
KLPQLCTEL |
55 |
HPV 16 E6 18-26 |
LQTTIHDII |
56 |
HPV 16 E6 26-34 |
FAFRDLCIV |
57 |
HPV 16 E6 52-60 |
YMLDLQPET |
58 |
HPV 16 E7 11-19 |
TLHEYMLDL |
59 |
HPV 16 E7 7-15 |
LLMGTLGIV |
60 |
HPV 16 E7 82-90 |
TLGIVCPI |
61 |
HPV 16 E7 86-93 |
LLMGTLGIVCPI |
62 |
HPV 16 E7 82-93 |
[0019] Unless otherwise specified, the epitopes in the hybrid polypeptides of the invention
may overlap to some degree, e.g., the first epitope may overlap (i.e., share at least
one amino acid residue, and share up to all but one residue) with the third epitope,
or they may be non-overlapping.
[0020] The polypeptide includes a targeting signal. A targeting signal is a peptide which
directs intracellular transport or secretion of a peptide to which it is attached.
The targeting signal can be at the amino terminus, e.g., a signal sequence, or carboxy
terminus, or within the hybrid polypeptide, so long as it functions in that site.
[0021] The targeting signal can be any recognized signal sequence, e.g., a signal sequence
from the adenovirus E3 protein. A preferred targeting signal is the signal peptide
of HLA-DRα: Met Ala Ile Ser Gly Val Pro Val Leu Gly Phe Phe Ile Ile Ala Val Leu Met
Ser Ala Gln Glu Ser Trp Ala (SEQ ID NO:63).
[0022] The targeting signal may optionally be modified to introduce an amino acid substitution
at the junction(s) between the targeting signal and the adjacent segment(s) to promote
cleavage of the targeting sequence from the epitopes by, erg., a signal peptidase.
[0023] Any of the segments within the hybrid polypeptide may be separated from the others
by a spacer amino acid or a spacer sequence.
[0024] The nucleic acid of the invention may encode a hybrid polypeptide including a first
epitope and a second epitope, wherein the first epitope is from a first HPV protein
and the second epitope is from a second HPV protein different from the first HPV protein,
provided that the sequence of the second epitope does not occur within the first HPV
protein, i.e., they are necessarily derived from different proteins. The different
proteins can be from the same or different strains of HPV, e.g., types 16 and 18.
The hybrid polypeptide can, of course, include additional epitopes from the same or
different HPV proteins, or from other pathogens or tumor antigens.
[0025] Also within the invention is a nucleic acid encoding a hybrid polypeptide including
a plurality (e.g., at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 30) MHC class binding
epitopes from an HPV protein. The sequence of the entire hybrid polypeptide is not
identical to the sequence of either a naturally occurring HPV protein or a fragment
of a naturally occurring HPV protein, by virtue of sequence insertions, internal deletions,
or substitutions, accomplished, e.g., by genetic engineering techniques.
[0026] The nucleic acid encodes a hybrid polypeptide that includes a plurality of HLA-binding
epitopes from an HPV strain 16 E6 protein, a plurality of HLA-binding epitopes from
an HPV, strain 16 E7 protein, a plurality of HLA-binding epitopes from an HPV strain
18 E6 protein, and a plurality of epitopes from an HPV strain 18 E7 protein. Each
plurality of epitopes can include an epitope selected from the group consisting of
an HLA-A1-binding epitope, an HLA-A2-binding epitope, an HLA-A3-binding epitope, an
HLA-A11-binding epitope, and an HLA-A24-binding epitope, and preferably at least two
or three selected from this group. The members of each plurality of epitopes are different
from the members of each of the other plurality of epitopes. Each plurality of epitopes
may include at least two HLA-A1-binding epitopes, at least two HLA-A2-binding epitopes,
at least two HLA-A3-binding epitopes, at least two HLA-A11-binding epitopes, and/or
at least two HLA-A24-binding epitopes. A given plurality can be distributed on more
than one segment.
[0027] The nucleic acid of the invention encodes a hybrid polypeptide comprising the peptide
segments of Fig. 5 (SEQ ID NO:157) and a signal sequence and does not comprise a sequence
identical to the sequence of either full length, intact E6 or full length intact E7
protein from HPV strain 16 or 18.
The polypeptide includes the segments.
AMFQDPQERPRKLPQLCTEL (SEQ ID NO:64), LLRREVYDFAFRDLCIVYRDGNPY (SEQ ID NO:65)
, KISEYRHYCYSLYGTTLEQQYNK (SEQ ID NO:66), TLHEYMLDLQPETTDLYSY (SEQ ID NO:67), QAEPDRAHYNIVTF
(SEQ ID NO:68), LLMGTLGIVCPICSQKP(SEQ ID NO:69), RRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFK
(SEQ ID NO: 152), SVYGDTLEKLTNTGLYNLLIRCLRCQK (SEQ ID NO:153), KATLQDIVLHLEPQNEIPV
(SEQ ID NO:154), HTMLCMCCKCEARI (SEQ ID NO:155), and AFQQLFLNTLSFVCPWC (SEQ ID NO:156).
The segments can be processed to produce multiple epitopes. The hybrid polypeptide
can include the peptide segments of Fig. 5, as well as additional HPV E6 or E7 sequence.
Most preferably, the segment is less than 100, 70, 50, 40, 30, or 20 amino acids.
The hybrid polypeptide does not contain a sequence identical to the sequence of either
full length, intact E6 or full length, intact E7 protein from HPV strain 16 or 18.
[0028] The nucleic acids described above can be provided in a plasmid, bacterial, or viral
vector. When the nucleic acids are used
in vivo, it is preferable to use plasmid vectors containing the above-described nucleic acids.
The vector is preferably an expression vector which contains one or more regulatory
sequences (which could include a promoter) which permit expression in a cell of interest.
The regulatory sequence(s) are operatively linked to the sequence encoding the hybrid
polypeptide, such that they drive expression of the latter.
[0029] A cell into which the nucleic acid of the invention has been introduced (e.g., by
transfection or infection) in the form of the plasmid, bacterial, or viral vector,
either transiently or stably can be, e.g., a B cell, dendritic cell (DC), Langerhans
cell, or other antigen presenting cell (APC). The cell may be cultured or otherwise
maintained under conditions permitting expression of the hybrid polypeptide from the
nucleic acid, e.g., the plasmid, encoding it.
[0030] As used herein, "isolated DNA" covers both (1) a DNA the full sequence of which does
not occur within any naturally occurring DNA, and (2) a DNA the full sequence of which
does occur within a naturally occurring DNA, but which is free of the genes that flank
that sequence in the genome of the organism in which that sequence naturally occurs.
The term therefore includes a recombinant DNA incorporated into a vector, into an
autonomously replicating plasmid or virus, or into the genomic DNA of a prokaryote
or eukaryote. It also includes a separate molecule such as a cDNA, a genomic fragment,
a fragment produced by polymerase chain reaction (PCR), or a restriction fragment.
[0031] The invention further includes hybrid polypeptides encoded by the above-described
nucleic acids. The hybrid polypeptides described herein may optionally include an
amino terminal methionine residue. The hybrid polypeptides described herein also may
optionally include a GLAG (or other monoclonal antibody determinant) or an antibody
recognition site (e.g., a myc or his tag) located directly 3' of the last epitope
coding sequence. Also included in the hybrid polypeptide are segments, as discussed
above. At least some of the segments correspond to portions of one or more naturally
occurring proteins. They may be separated by spacer amino acids or spacer peptides.
[0032] The hybrid polypeptide described herein can be a substantially pure polypeptide.
"Substantially pure polypeptide" covers both (1) a polypeptide the full sequence of
which is not identical to that of any naturally occurring polypeptide, and (2) a polypeptide
which does have the sequence of a naturally occurring polypeptide, but which is separated
from those components (proteins and other naturally-occurring organic molecules) which
naturally accompany it in the biological context (e.g., cell) in which it naturally
occurs. Typically, the polypeptide is substantially pure when it constitutes at least
60%, by weight, of the protein in the preparation. Preferably, at least 75%, more
preferably at least 90%, and most preferably at least 99%, by weight, of the protein
in preparation is the polypeptide.
[0033] The nucleic acids (e.g., viral, bacterial, or plasmid vectors) or hybrid polypeptides
can optionally be provided in a microparticle that also includes a polymeric matrix.
In preferred embodiments, the polymeric matrix consists essentially of poly-lactic
acid (PLA), poly-glycolic acid (PGA), or a copolymer of poly-lactide-
co-glycolide acid (PLGA). The microparticle preferably has a diameter of, e.g., 0.02
to 20 microns, or less than about 11 microns. A plurality of the microparticles preferably
has an average diameter of, e.g., 0.02 to 20 microns, less than about 11 microns,
or less than about 5 microns.
[0034] The nucleic acids and hybrid polypeptides described herein can alternatively be incorporated
into liposomes or immune-stimulating complexes (ISCOMS) or delivered with naturally
occurring polymers, synthetic polymers, biopolymers, cationic lipids, condensing agents,
dendrimers, other biomaterials, oil-containing adjuvants, and other adjuvants such
as QS21 or saponin. The nucleic acids and hybrid polypeptides described herein may
alternatively be administered using any other suitable delivery vehicle known in the
art, or can be delivered without a delivery vehicle (other than aqueous solution),
e.g., "naked DNA".
[0035] The invention in addition includes a therapeutic composition containing the above-described
nucleic acids or polypeptides, a pharmaceutically acceptable carrier, and optionally,
one of the above-discussed delivery vehicles.
[0036] Also provided is a method of eliciting an immune response (e.g., an antibody response
or a cellular immune response, including an MHC class I-mediated or class II-mediated
immune response) in a mammal by administering the above-described nucleic acids or
hybrid polypeptides to the mammal. Preferably, the mammal bears at least one MHC class
I or II allotype which binds to an epitope derived from the polyepitope polypeptide.
The mammal can be, e.g., a human, non-human primate, dog, cat, rabbit, cow, horse,
sheep, pig, goat, mouse, rat, guinea pig, or hamster.
[0037] When at least one of the epitopes is an HPV epitope, appropriate subjects for the
method include, e.g., a human who suffers from, or is at risk of, condyloma, e.g.,
exophytic condyloma, flat condyloma, cervical cancer, other HPV-associated-cancers
diseases or conditions, respiratory papilloma, conjunctival papilloma, genital-tract
or anal-tract HPV infection, or cervical dysplasia. The nucleic acid or hybrid polypeptide,
or delivery vehicle containing one or more of these compositions, can be administered
directly to a mucosal tissue, e.g., vaginal, nasal, lower respiratory, ocular, or
applied to gastrointestinal (e.g., rectal, cervical, or dermal) tissue, of the mammal.
Alternatively, the nucleic acid or hybrid polypeptide, or delivery vehicle containing
the same, can be administered systemically: for example, intravenously, intramuscularly,
intradermally, orally, subcutaneously, intraarterially, intraperitoneally, or intrathecally.
[0038] By "spacer amino acid" is meant a single residue inserted between two neighboring
segments. ("A" and "B", in that order) in a polypeptide of the invention, where the
residue is different from the amino acid which flanks the carboxy terminus of A and
also is different from the amino acid which flanks the amino terminus ofB in the respective
full length proteins from which A and B were derived ("X" and "Y", respectively).
Thus, the spacer amino acid forms a point of discontinuity from the X-derived sequence
of A and the Y-derived sequence of B, in the polypeptide of the invention. Typically,
the amino acid will be one of the twenty naturally occurring amino acids, e.g., Ala,
Leu, Ile, or Gly, and in general can be any amino acid except (1) the one that naturally
flanks the carboxy terminus of A in protein X, and (2) the one that naturally flanks
the amino terminus of B in protein Y.
[0039] By "spacer sequence" is meant a sequence of two or more amino acid inserted between
two neighboring segments, e.g., "A" and "B", in a polypeptide of the invention. The
sequence of the spacer is different from the sequences which flank the carboxy terminus
of A and the amino terminus of B in the respective full length proteins ("X" and "Y")
from which A and B were derived. Thus, the spacer sequence forms a point of discontinuity
from both the X-derived sequence of A and the Y-derived sequence of B in the polypeptide
of the invention.
[0040] Examples of spacer sequences include Ala Ala, Ala Leu, Leu Leu, Leu Ala, Leu Ile,
Ala Ala Ala, Ala Gly Leu, Phe Ile Ile, etc. Generally, the spacer sequence will include
nonpolar amino acids, though polar residues such as Glu, Gln, Ser, His, and Asn could
also be present, particularly for spacer sequences longer than three residues. The
only outer limit on the total length and nature of each spacer sequence derives from
considerations of ease of synthesis, proteolytic processing, and manipulation of the
polypeptide and/or nucleic acid. It is generally unnecessary and probably undesirable
to use spacer sequences longer than about four or five residues, though they could
be, for example, up to 6, 8, 10, 15, 20, 30, or 50 residues. Of course, they could
be even longer than 50 residues.
[0041] Spacer amino acids and spacer sequences are useful for promoting processing to release
epitopes. The spacers are typically removed from the polypeptide by proteolytic processing
in the cell, along with any sequence between epitopes within a given segment. This
leaves the epitopes intact for binding to MHC molecules or (upon secretion from the
cell) antibodies. Occasionally a spacer amino acid or part of a spacer sequence will
remain attached to an epitope through incomplete processing. This generally will have
little or no effect on binding to the MHC molecule.
[0042] An advantage of the invention is that it permits delivery of MHC class 1 or class
II-binding epitopes from polypeptides having only a partial sequence of a protein
of a pathogen or tumor antigen. Thus, problems associated with interference of antigen
presentation by viral proteins; or deleterious effects seen in over-expression of
particular viral proteins or tumor antigens, are avoided.
[0043] Another advantage of the invention is that the nucleic acid sequences, or delivery
vehicles containing the nucleic acid sequences, may promote associated immune responses,
e.g., IL-12 and γ-interferon (IFN) release from macrophages, NK cells, and T cells.
For instance, phagocytosis of microspheres containing DNA in general can promote TNF
and IFN secretion by human APC.
[0044] A further advantage of the invention is that the assortment of epitopes within the
polyepitope polypeptides described herein increases the likelihood that at least one
epitope will be presented by each of a variety of HLA allotypes. This allows for immunization
of a population of individuals polymorphic at the HLA locus, using a single hybrid
polypeptide or nucleic acid encoding the polypeptide. The hybrid polypeptide can be
specific for a particular pathogen, including two or more strains of the same pathogen,
or can contain epitopes derived from two or more pathogens. In addition, the hybrid
polypeptide can be specific for a particular tumor antigen, or can contain epitopes
derived from two or more tumor antigens.
[0045] Unless otherwise defined, all technical and scientific terms used herein have the
same meaning as commonly understood by one of ordinary skill in the art to which this
invention belongs. Suitable methods and materials are described below, although methods
and materials similar or equivalent to those described herein can also be used in
the practice or testing of the present invention.
[0046] In addition, the materials, methods, and examples are illustrative only and not intended
to be limiting.
[0047] Other features and advantages of the Invention will be apparent from the following
detailed description, and from the claims,
Brief Description of the Drawings
[0048]
Fig. 1 is a schematic drawing of a polyepitope polypeptide which includes four segments,
each segment including multiple epitopes.
Fig. 2 is a schematic drawing of a polyepitope polypeptide including the amino acid
sequences of segments derived from the HPV strain 16 E6 and E7 proteins.
Fig. 3 is a graph illustrating the results of an in vitro assay in which human T cells stimulated with the peptide HPV 16E7 44-52 were tested
against HLA-A1/A3-expressing targets infected with either wildtype vaccinia vector
(open circles) or vaccinia vector encoding HPV 16E7 44-52 as part of an HPV 16 E6/E7
polyepitope polypeptide.
Fig. 4 is a schematic drawing of a polyepitope polypeptide including the amino acid
sequences of segments derived from the HPV strain 18 E6 and E7 proteins.
Fig. 5 is a schematic drawing of a polyepitope polypeptide including the amino acid
sequences of segments derived from the E6 and E7 proteins of HPV strains 16 and 18.
Fig. 6 is a graph illustrating the results of an in vitro assay in which T cells from DNA-immunized mice were expanded in vitro by exposure to peptide 124 or peptide 272 and subsequently tested against target
cells infected with wildtype vaccinia vector, vaccinia vector encoding HPV Dra 16/18,
or vaccinia vector encoding HPV 16/18.
Detailed Description
[0049] The present invention provides nucleic acids encoding polyepitope polypeptides which
include multiple immunogenic segments, each segment containing one or more MHC class
I or II-restricted epitopes, or both. Nucleic acids and polypeptides of the invention
are useful for generating or enhancing prophylactic or therapeutic immune responses
against pathogens, tumors, or autoimmune disease in a population of individuals having
diverse MHC allotypes. In addition, the nucleic acids and polypeptides of the invention
are also useful as positive controls in T cell stimulation assays
in vitro, and as tools to understand processing of epitopes within cells.
[0050] One or more of the segments present within the polyepitope polypeptide can be processed
into multiple distinct epitopes to form either MHC class I-binding epitopes, which
are typically associated with cytotoxic T cell (CTL) immune responses, or MHC class
II-binding epitopes, which are typically associated with helper T cell immune responses.
Other epitopes can be B cell epitopes which stimulate production of epitope-specific
antibodies.
[0051] Included in the invention are nucleic acids encoding polyepitope polypeptides useful
for preventing or treating HPV-associated infections, particularly infections associated
with warts, cervical or anal dysplasia, cervical cancer, and other HPV-associated
cancers. For example, the polypeptides and nucleic acids of the invention can be used
as vaccines prophylactically or therapeutically in subjects known to be infected by
HPV, suspected of being infected by HPV, or likely to become infected by HPV. Other
suitable subjects include those displaying symptoms of, or likely to develop, HPV-associated
conditions. The immunogenic polypeptides, and nucleic acids encoding these polypeptides,
can also be used as vaccines for preventing or treating conditions associated with
infections of HPV strain 16, e.g., bowenoid papulosis, anal dysplasia, respiratory
or conjunctival papillomas, cervical dysplasia, cervical cancer, vulval cancer, or
prostate cancer. They can also be used to treat conditions associated with other HPV
strains, especially those associated with HPV strains 6, 11, 18, 31, 33, 35, and 45.
These conditions include, e.g., exophytic condyloma (HPV strains 6 and 11), flat condyloma,
especially of the cervix (HPV strains 6, 11, 16, 18, and 31), giant condyloma (HPV
strains 6 and 11), cervical cancer (HPV strains 18, 31, and 33, in addition to HPV
strain 16), respiratory and conjunctival papillomas (HPV 6 and 11), and infection
with genital-tract HPVs (HPV 6, 11, 16, 18, 31, 33, and 35).
Identification of MHC-binding epitopes from HPV proteins
[0052] For an epitope to generate effective cytotoxic T cell (CTL) responses, it must bind
to an MHC molecule on an antigen-presenting cell (APC), and the resulting receptor-ligand
complex must be recognized by a T cell receptor expressed on the CTL. Epitopes which
bind to a specific MHC allele can be identified by first synthesizing a series of
overlapping peptide fragments from a protein of interest, e.g., an HPV protein such
as HPV E6 or E7, and testing the peptides in art-recognized binding studies with a
radiolabeled peptide known to bind to the MHC allele. If a test peptide demonstrates
specific binding to an MHC allele as measured by, for example, competition with the
radiolabeled test peptide (i.e., it is an epitope), the epitope can be combined with
additional epitopes (overlapping or adjacent) to produce or define a segment.
[0053] Alternatively, epitopes can be identified by refolding soluble MHC molecules in the
presence of radiolabeled β2-microglobulin and a test peptide. The complete complex
will refold and produce a receptor of the correct size. β2-microglobulin dissociates
from the complex at a measurable rate that is directly correlated with the binding
affinity of the test peptide (
Garboczi et al., Proc. Nat. Acad. Sci. USA 89:3429-33, 1992;
Parker et al., J. Biol. Chem. 267:5451-5459, 1992; and
Parker et al., J. Immunol. 149: 1896-1904, 1992). Analysis of this type of data has resulted in an algorithm that predicts the dissociation
times of a given test peptide for an HLA-A2 receptor (
Parker et al., J. Immunol. 152:163-175, 1994). Fast dissociation has been correlated with low affinity, and slow dissociation
with high affinity. This algorithm has been expanded and is available for predicting
binding affinity of epitopes for the HLA-A allotypes, -A1, -A2, -A3, -A11, and -A24.
The algorithm can be found at the web site (http://wwwbimas.dcrt.nih.gov/molbio/hla_bind/index.html).
Most of the HPV 16 E6 and E7 epitopes that are known in the art to bind one of the
five listed HLA-A receptors are predicted by this algorithm to cause β2-microglobulin
dissociation times of greater than 2 h.
[0054] Epitope binding can also be determined using previously identified epitopes derived
from HPV 16 E6 and E7 (
Kast et al., J. Immunol. 152:3904-12, 1994). Additional binding studies on other HPV putative epitopes, e.g., HPV 18 E6-and
E7- derived epitopes, are performed using overlapping 8, 9, or 10-mers from the HPV
18 E6 and E7 proteins in binding assays involving each of the five HLA-A allotypes,
using one of the above-described protocols.
T cell assays for epitopes
[0056] Epitopes which bind
in vitro to MHC molecules as described above can be analyzed for their effectiveness at stimulating
human T cell-responses in an
in vitro immunization assay. The assay has been used previously to identify human and murine
T cell-responsive epitopes, including several that are derived from HPV proteins (
Alexander et al., Amer. J. Obstet, and Gynecol. 1-75:1586-1593, 1996;
Tarpey et al., Immunology 81:222-27, 1994). These assays have also been used to generate large numbers of specific CTL for
immunotherapy (
Tsai et al., Crit. Rev. Immunol. 18:65-75, 1998). To ensure reliability, it is desirable to perform the first round of T cell stimulation
in the presence of dendritic cells (DCs) pulsed with the test peptide. Moreover, inclusion
of IL-10 during the stimulation may suppress the non-specific responses that may sometimes
arise during culture of the cells. T cell activation may then be examined using an
ELISA assay to measure γ-IFN secretion, or by use of FACS to determine the increase
in CD8+, CD 16- cells containing γ-IFN by tricolor analysis. Alternatively, T cell
activation can be measured using a
51Cr release CTL assay or a tetramer-based assay.
[0057] It is possible that not every individual with a given allotype will respond to a
particular epitope. For example, one individual whose cells bear the HLA-A2 allotype
may respond to a given epitope, whereas a second such individual may not. One reason
for this differential responsiveness may be that those individuals who have been infected
with HPV previously have a higher precursor T cell frequency than a naive individual.
Another may be related to differences in the T cell repertoire between the two individuals.
To overcome this difficulty, T cells from two donors, and even more preferably three
donors, for each HLA allotype can be tested. For the more common alleles (i.e., HLA-A2
and -A3) up to four donors are preferably tested.
[0058] Each epitope is tested initially with cells from one donor. If an epitopes does not
stimulate a T cell response using cells of the first donor, it is tested again with
cells from a second donor, and then a third donor. If the epitope does not demonstrate
T cell reactivity after two or three attempts, it is preferably not represented in
the polypeptides of the invention.
[0059] Altering the method by which the
in vitro presentation of antigen is performed may enhance analysis. An initial stimulation
ofT cells with DCs is typically part of the
in vitro immunization. To enhance the immunization, DCs can be added at each round of stimulation
to ensure adequate antigen presentation and T cell stimulation, e.g., using previously
generated and subsequently frozen DCs. Leukopaks or blood samples can be obtained
from individuals with high grade squamous intraepithelial lesions (HSIL) or cervical
cancer. These individuals may have been primed
in vivo and have increased numbers of T cells in their blood.
[0061] The amino acid sequence of a hybrid polypeptide (SEQ ID NO: 126) based on sequences
found in the HPV strain 16 E6 and strain 16 E7 proteins is shown in Fig. 2. The hybrid
polypeptide is created by fusion of fragments of the E6 protein (amino acids 7-26
(SEQ ID NO:64), 44-67 (SEQ ID NO:65), and 79-101 (SEQ ID NO:66)) and the E7 protein
(amino acids 7-25 (SEQ ID NO:67), 44-57 (SEQ ID NO:68), and 82-98 (SEQ ID NO:69)).
To prevent retinoblastoma (Rb) protein binding to the hybrid polypeptide, amino acids
26 and 27 of the E7 protein are not included. In addition, the cysteine at amino acid
24 has been converted to a serine residue. In the parlance defined above, this renders
that serine residue, together with residue 25, a "spacer sequence" between segments
corresponding to E7 protein residues 7-23 and 44-57, respectively.
[0062] The amino acid sequence of a second hybrid polypeptide (SEQ ID NO:159) based on sequences
found in the HPV strain 18 E6 and strain 18 E7 proteins is shown in Fig. 4. The hybrid
polypeptide is created by fusion of fragments of the E6 protein (amino acids 9-50
(SEQ ID NO:152) and 84-110 (SEQ ID NO: 153)), and the E7 protein (amino acids 5-23
(SEQ ID NO:154), 59-72 (SEQ ID NO: 155), and 85-101 (SEQ ID NO: 156)).
[0063] The amino acid sequence of a third hybrid polypeptide (SEQ ID NO:157) based on sequences
found in the E6 and E7 proteins of HPV strains 16 and 18 is shown in Fig. 5. The hybrid
polypeptide is created by fusion of fragments of the HPV strain 16 E6 protein (amino
acids 7-26 (SEQ ID NO:64), 44-67 (SEQ ID NO:65), and 79-101 (SEQ ID NO:66)), the HPV
strain 16 E7 protein (amino acids 7-25 (SEQ ID NO:67), 44-57 (SEQ ID NO:68), and 82-98
(SEQ ID NO:69)), the HPV strain 18 E6 protein (amino acids 9-50 (SEQ ID NO:152) and
84-110 (SEQ ID NO:153)), and the HPV strain 18 E7 protein (amino acids 5-23 (SEQ ID
NO:154), 59-72 (SEQ ID NO:155), and 85-101 (SEQ ID NO:156)). As described above with
respect to the hybrid polypeptide of SEQ ID NO:126, those amino acids of the HPV strain
16 E7 protein that would cause the polypeptide to bind to the Rb protein are excluded.
Furthermore, an inserted spacer sequence identical to that present in SEQ ID NO:126
lies between the segments corresponding to residues 7-23 and 44-57, respectively.
[0064] Any of the hybrid polypeptides described herein may optionally include an initiator
methionine, a leader sequence, or any targeting sequence (e.g., a transmembrane domain).
The terms "targeting sequence" and "trafficking sequence" are used interchangeably
herein. For example, when the third hybrid polypeptide has a methionine added to its
amino terminus, it has the amino acid sequence of SEQ ID NO:158 and is encoded by
a nucleotide sequence of SEQ ID NO:161. Furthermore, when the third hybrid polypeptide
has an HLA-DRα leader sequence added to its amino terminus, it has the amino acid
sequence of SEQ ID NO:160 and is encoded by a nucleic acid having the nucleotide sequence
of SEQ ID NO:162.
[0065] Table 3 lists other MHC-binding epitopes from the HPV strain 16 E6 and E7 and the
HPV strain 18 E6 and E7 polypeptides. Any of these epitopes can be incorporated into
a hybrid polyepitope of the invention.
TABLE 3: HPV E6 and E7 MHC-binding epitopes
HPV 16 E6 Peptides |
SEQ ID NO |
A1 - binding |
|
|
ISEYRHYCY |
70 |
|
FQDPQERPR |
71 |
|
RREVYDFAF |
72 |
|
TTLEQQYNK |
73 |
|
FQDPQERPRK |
74 |
|
ISEYRHYCYS |
75 |
|
KISEYRHYCY |
76 |
|
GTTLEQQYNK |
77 |
A2 - binding |
|
|
KLPQLCTEL |
55 |
|
KISEYRHYC |
78 |
|
FAFRDLCIV |
57 |
|
YCYSIYGTTL |
79 |
|
SEYRHYCYSL |
80 |
A3 - binding |
|
|
AMFQDPQER |
81 |
|
LLRREVYDF |
82 |
|
TTLEQQYNK |
73 |
|
IVYRDGNPY |
83 |
|
KLPQLCTEL |
55 |
A11 - binding |
|
|
TTLEQQYNK |
73 |
|
GTTLEQQYNK |
77 |
A24 - binding |
|
|
VYDFAFRDL |
84 |
|
CYSLYGTTL |
85 |
|
EYRHYCYSL |
86 |
|
KLPQLCTEL |
55 |
|
DPQERPRKL |
87 |
|
HYCYSLYGT |
88 |
|
DFAFRDLCI |
89 |
|
LYGTTLEQQY |
90 |
|
HYCYSLYGTT |
91 |
|
EVYDFAFRDL |
92 |
|
EYRHYCYSLY |
93 |
|
VYDFAFRDLC |
94 |
|
YCYSIYGTTL |
79 |
HPV 16 E7 Peptides |
SEQ ID NO |
A1 - binding |
|
|
QAEPDRAHY |
95 |
|
IVCPICSQK |
96 |
|
QPETTDLY |
97 |
|
QAEPDRAHYN |
98 |
|
DLQPETTDLY |
99 |
A2 - binding |
|
|
|
YMLDLQPET |
58 |
|
TLHEYMLDL |
59 |
|
LLMGTLGIV |
60 |
|
LMGTLGIVC |
100 |
|
MLDLQPETT |
101 |
|
TLGIVCPIC |
102 |
|
DLQPETTDL |
103 |
|
GTLGIVCPI |
104 |
|
YMLDLQPETT |
105 |
|
LQPETTDLY |
106 |
|
LLMGTLGIVC |
107 |
A3 - binding |
|
|
|
TLHEYMLDL |
59 |
|
IVCPICSQK |
96 |
A11 - binding |
|
|
IVCPICSQK |
96 |
A24 - binding |
|
|
DLQPETTDL |
103 |
|
TLHEYMLDL |
59 |
|
TPTLHEYML |
108 |
|
RAHYNIVTF |
109 |
|
GTLGIVCPI |
104 |
|
EPDRAHYNI |
110 |
HPV 18 E6 Peptides |
SEQ ID NO |
A1 - binding |
|
|
LTEVFEFAFK |
127 |
A2 - binding |
|
|
KLPDLCTEL |
124 |
|
GLYNLLIRC |
128 |
|
SLQDIEITC |
129 |
|
SLQDIEITCV |
130 |
|
LQDIEITCV |
131 |
|
KTVLELTEV |
132 |
|
ELTEVFEFA |
133 |
|
KLTNTGLYNL |
134 |
|
LTNTGLYNL |
135 |
|
GLYNLLIRCL |
125 |
A3 - binding |
|
|
VLELTEVFEF |
136 |
|
SVYGDTLEK |
137 |
|
LLIRCLRCQK |
138 |
A11 - binding |
|
CVYCKTVLEL |
139 |
|
SVYGDTLEK |
137 |
|
LLIRCLRCQK |
138 |
A24 - binding |
|
VYCKTVLEL |
140 |
|
VYGDTLEKL |
141 |
|
LTNTGLYNLL |
142 |
HPV 18 E7 Peptides |
SEQ ID NO |
A1 - binding |
|
|
HLEPQNEIPV |
143 |
A2 - binding |
|
|
TLQDIVLHL |
144 |
|
ATLQDIVLHL |
145 |
|
QLFLNTLSFV |
146 |
|
MLCMCCKCEA |
147 |
|
CMCCKCEARI |
148 |
|
FQQLFLNTL |
149 |
|
TLSFVCPWC |
150 |
A3 - binding |
|
|
HTMLCMCCK |
122 |
A11 - binding |
|
HTMLCMCCK |
122 |
A24 - binding |
|
QLFLNTLSF |
123 |
|
FQQLFLNTL |
149. |
|
AFQQLFLNTL |
151 |
Nucleic acids encoding polypeptides containing multiple HPV epitopes
[0066] Nucleic acids encoding polyepitope polypeptides containing epitopes identified as
described above can be generated using standard techniques, e.g., by overlapping PCR
or linking of oligonucleotides. Preferably, codons are selected for inclusion in the
construct to optimize production of the polyepitope polypeptides in bacterial or mammalian
systems.
[0067] Different segments in the encoded polyepitope polypeptide, e.g., segments derived
from different proteins, or from non-adjacent regions of the same protein, can be
checked using a sequence analysis program; e.g., the BLAST program, to determine if
the amino acid sequences ar the junctions of the segments show inadvertent similarity
to known human proteins. If homologies exist, the polypeptide can be redesigned to
alter the order of the epitopes in the polypeptide to eliminate the regions of homology.
If a particular epitope itself is over 75% identical to a portion of a known human
protein, it is preferably not included in the polyepitope polypeptide.
[0068] The order of the segments within a given polyepitope polypeptide can correspond to
the order in which the segments appear in the native protein, though some of the amino
acid sequence between (i.e., at least one residue) the individual segment in the native
protein may be deleted. Alternatively, the segment order may differ from that in the
naturally occurring protein. The latter arrangement is preferable if a natural alignment
results in a polypeptide having regions of homology to a human protein.
[0069] For HPV-derived epitopes, the nucleic acid construct preferably does not encode an
epitope which contains the known retinoblastoma protein (Rb)-binding site in the HPV
E7 protein. The construct can encode, e.g., a polypeptide which includes segments
from each of the HPV 16 E6, HPV 16 E7, HPV 18 E6, and HPV 18 E7 proteins, where each
segment contains epitopes for binding to one or more of the HLA alleles HLA-A1, HLA-A2,
HLA-A3, HLA-A11, and HLA-A24. This corresponds to about 12-20 epitopes per HLA allele,
for about 60-100 epitopes in the polyepitope polypeptide.
[0070] Regulatory elements can be included in the construct to facilitate expression of
the nucleic acid encoding the polyepitope polypeptide. These elements include sequences
for enhancing expression in human or other mammalian cells, e.g., promoters, RNA stabilization
sequences 5' and/or 3' to the coding sequence, introns (which can be placed at any
location within or adjacent to the encoded sequence), and poly(A) addition sites,
as well as an origin of replication and one or more genes encoding selectable markers
enabling the constructs to replicate and be selected in prokaryotic and/or eukaryotic
hosts. A T7 polymerase promoter or other type of promoter (e.g., a tissue-specific
promoter such as a muscle-specific promoter, or a cell-specific promoter such as an
APC-specific promoter) is optionally present at the 5' end of the coding sequence,
and a sequence encoding a FLAG or other mAb determinant is optionally present directly
3' of the last epitope coding sequence. The construct may also contain other transcriptional
and translational signals, such as a Kozak sequence.
[0071] The construct may in addition include a sequence encoding a targeting signal that
directs the polyepitope polypeptide to a desired intracellular compartment, the targeting
signal being linked to the polypepitope polypeptide. Targeting signals can direct
the polyepitope polypeptide to endoplasmic reticulum (ER), the golgi, the nucleus,
a lysosome, a class II peptide loading compartment, or an endosome, and include signal
peptides (the amino terminal sequences which direct proteins into the ER during translation),
ER retention peptides such as KDEL (SEQ ID NO:111), and lysosome-targeting peptides
such as KFERQ (SEQ ID NO:112), QREFK (SEQ ID NO:113), and other pentapeptides having
Q flanked on one side by four residues selected from K, R, D, E, F, I, V, and L. Also
included are targeting signals that direct insertion of the polypeptide into a membrane
(e.g., a transmembrane sequence). Polypeptides including a membrane insertion sequence
can be constructed either with or without a cytoplasmic tail.
[0072] An example of an ER-targeting sequence is the HLA-DRα leader sequence, Met Ala Ile
Ser Gly Val Pro Val Leu Gly Phe Phe Ile Ile Ala Val Leu Met Ser Ala Gln Glu Ser Trp
Ala (SEQ ID NO:63). The targeting sequence may include only a portion (e.g., at least
ten amino acid residues) of this specified 25 residue sequence, provided that the
portion is sufficient to cause targeting of the polypeptide to the ER.
[0073] Nuclear localization sequences include nucleoplasmin- and SV40-like nuclear targeting
signals, as described in
Chelsky et al., Mol. Cell Biol. 9:2487, 1989;
Robbins, Cell 64:615, 1991, and
Dingwall et al., TIBS 16:478, 1991. Some nuclear localization sequences include AVKRPAATICKAGQAKKK (SEQ ID NO:114),
RPAATKKAGQAKKKKLD (SEQ ID NO:115), and AVKRPAATKKAGQAKKKLD (SEQ ID NO: 116).
[0074] In some cases it is desirable to modify the amino acid sequence of the targeting
signal to facilitate cleavage by a signal peptidase or other proteolytic agent. Recognition
sequences for signal peptidases are described in
Von Heijne, Nucleic Acids Research 14:4683, 1986. The -3, -1 rules of von Heijne can be used to select a sequence that increases the
probability of successful cleavage by signal peptidase when the targeting signal is
present.
[0075] The nucleic acids encoding the polyepitope polypeptide described herein may optionally
encode a methionine residue at the amino terminus of the polypeptide to facilitate
translation.
[0077] Epitope-containing segments derived from a single protein can appear in the order
(i.e., from amino terminus to carboxy terminus) in which they appear in the protein.
Alternatively, segments from a given protein can be arranged in an order other than
that in which they appear in the native protein, and can be grouped together or mixed
with segments from one or more other proteins. The construct can encode a single polyepitope
polypeptide or multiple polyepitope polypeptides, each under the control of a different
promoter, e.g., dual promoter vectors. A dual promoter vector permits two shorter
polyepitope polypeptides to replace the single longer version, with no loss in the
number of epitopes produced from a given vector. It also allows adding new epitopes
without altering the sequence and perhaps the processing, of the first polyepitope
polypeptide.
[0078] Nucleic acids encoding polyepitope polypeptides can be used in any vector that allows
for expression in antigen-presenting cells (APC) of the patient. The vector is preferably
a non-integrating viral vector or is a non-viral vector such as a plasmid or bacterial
vector. An example of a suitable vector is the family of pcDNA mammalian expression
vectors (Invitrogen), which permit direct and rapid cloning of PCR products. The vector
can be modified to include additional epitopes, e.g., MHC class I HLA-A1, -2, -3,
-11, and -24 restricted epitopes from the HPV E6 and E7 proteins of the HPV 16 and
18 strains.
[0079] To determine whether the polypeptide is processed and the expected epitopes are presented
by HLA, an
in vitro T cell stimulation assay can be performed using autologous PBL or EBV-transformed
cells infected with a recombinant vaccinia virus that contains the polyepitope polypeptide
coding sequence. These target cells are generated by incubating PBL with the recombinant
vaccinia at an m.o.i of 3-10 pfu/cell at 37°C for 2 h. After infection, cells are
pelleted, washed and used as targets in the
in vitro stimulation assay. The stimulated T cells from one or more individuals with the different
HLA allotypes are incubated with the target cells, and the ability of the target cells
to stimulate the T cells is measured, e.g., by γ-interferon expression or secretion.
[0081] In addition to the T cell assays, an assay that utilizes transgenic animals can be
used to verify that the construct functions (e.g., epitopes are correctly processed
and presented) when delivered
in vivo. For measuring HLA-A2-restricted presentation, the polyepitope construct in a mammalian
expression vector (e.g., a plasmid) is encapsulated in microspheres and introduced
into HLA-A2 transgenic mice by a route such as intramuscular or subcutaneous injection.
The construct may alternatively be administered without the microsphere delivery vehicle,
e.g., in a recombinant vaccinia virus or as naked DNA. T cell responses are subsequently
examined
in vitro (
Hedley et al., Nature Med. 4:365-68, 1998). Target cells are T2A2 cells (T2 cells transfected with DNA encoding HLA-A2) or
EL4.A2 cells (EL4 cells transfected with DNA encoding HLA-A2) pulsed with the A2 epitope
being tested and T2A2 cells into which has been introduced a nucleic acid of the invention.
Parallel studies are performed using T2A2 cells pulsed with no peptide or with an
irrelevant peptide. In this way, HLA-A2 epitopes that are processed and presented
in vivo following administration of the nucleic acid of the invention are identified. A positive
result suggests that processing of the polyepitope polypeptide is occurring as predicted.
[0082] The nucleic acid encoding the polyepitope polypeptide, as well as the polyepitope
polypeptide itself, can be used in manufacture of a medicament for the prevention
or treatment of a tumor or an infection with a pathogen (e.g., HPV), or conditions
associated with such infection.
Delivery of Epitopes and Nucleic Acids Encoding Immunogenic Epitopes
[0083] Various art-recognized delivery systems may be used to deliver polyepitope polypeptides,
or nucleic acids encoding polyepitope polypeptides, into appropriate cells. An advantage
of DNA delivery of antigenic MHC class I-restricted epitopes is that the epitopes
are produced inside the target cell itself, where the interaction with a class I MHC
molecule to which the immunogenic epitope binds is kinetically favored. This is in
contrast to standard vaccine protocols which do not specifically direct antigenic
epitopes to MHC molecules intracellularly so that the epitopes may bind with the MHC
molecules prior to presentation of the MHC molecules on the cell surface.
[0084] The polyepitope polypeptides and nucleic acids encoding the polyepitope polypeptides
can be delivered in a pharmaceutically acceptable carrier such as saline, or as colloidal
suspensions, or as powders, with or without diluents. They can be "naked" or associated
with delivery vehicles and delivered using delivery systems known in the art, such
as lipids, liposomes, microspheres, microparticles or microcapsules, gold particles,
ISCOMS, nanoparticles, polymers, condensing agents, polysaccharides, polyamino acids,
dendrimers, saponins, QS21, adsorption enhancing materials, adjuvants, or fatty acids.
Examples of suitable microparticles are presented below.
[0085] The polyepitope polypeptides, or nucleic acids encoding the polyepitope polypeptides,
can be administered using standard methods, e.g., those described in
Donnelly et al., J. Imm. Methods 176:145, 1994, and
Vitiello et al., J. Clin. Invest. 95:341, 1995, and can be delivered into subjects in any manner known in the art, e.g., orally
intramuscularly, intravenously, intraarterially, intrathecally, intradermally, intraperitoneally,
intranasally, intrapulmonarily, intraocularly, intravaginally, intrarectally or subcutaneously.
They can be introduced into the gastrointestinal tract or the respiratory tract, e.g.,
by inhalation of a solution or powder containing the microparticles. Administration
can be local (e.g., at the cervix, skin, or other site of HPV infection) or systemic.
[0086] It is expected that a dosage of approximately 0.1 to 100 µmoles of the polypeptide,
or of about 1 to 2000 µg of DNA, would be administered per kg of body weight per dose.
Where the patient is an adult human, vaccination regimens can include, e.g., intramuscular,
intravenous, oral, or subcutaneous administrations of 10-1000 µg of a plasmid DNA
when delivered in a microparticle, or of about 10-2500 µg, e.g., 100 to 2000, or 500
to 1000 µg, of naked plasmid DNA delivered intramuscularly or intradermally, repeated
3-6 times. Of course, as is well known in the medical arts, dosage for any given patient
depends upon many factors, including the patient's size, general health, sex, body
surface area, age, the particular compound to be administered, time and route of administration,
and other drugs being administered concurrently. Determination of optimal dosage is
well within the abilities of a pharmacologist of ordinary skill.
[0087] Other standard delivery methods, e.g., biolistic transfer or
ex vivo treatment, can also be used. In
ex vivo treatment, antigen presenting cells (APCs) such as dendritic cells, peripheral blood
mononuclear cells, or bone marrow cells can be obtained from a patient or an appropriate
donor and activated
ex vivo with the immunogenic compositions, and then implanted or reinfused into the patient.
[0088] The nucleic acids encoding the polyepitope polypeptides, or the polyepitope polypeptides
themselves, can be administered alone or in combination with other therapies known
in the art, e.g., chemotherapeutic regimens, radiation, and surgery, to treat tumors
or infection, e.g., HPV infections or diseases associated with HPV infections In addition,
the polypeptides and nucleic acids of the invention can be administered in combination
with other treatments designed to enhance immune responses, e.g., by co-administration
with adjuvants or cytokines (or nucleic acids encoding cytokines), as is well known
in the art.
Microsphere Delivery
[0089] In one preferred delivery method, nucleic acids encoding the polyepitope polypeptides,
or the polyepitope polypeptides themselves, are delivered using microspheres. Microspheres,
including those described in
U.S. Patent No. 5,783,567, can be used as vehicles for delivering macromolecules such as DNA, RNA, or polypeptides
into cells. The microspheres contain the macromolecules embedded in a polymeric matrix
or enclosed in a hollow shell of polymer. Solid microspheres may also be formed for
example as in
WO 95/24929, herein incorporated by reference. The term microsphere, as used herein, includes
microparticles and microcapsules. Microspheres act to maintain the integrity of the
macromolecule, e.g., by maintaining the encapsulated DNA in a nondegraded state. Microspheres
of an appropriate size or combination of sizes can also be used for pulsed delivery
of the macromolecule, and for delivery at a specific site or to a specific target
cell population.
[0090] The polymeric matrix can be a biodegradable polymer such as polylactide-co-glycolide(PLG),
polylactide, polyglycolide, polyanhydride, polyorthoester, polycaprolactone, polyphosphazene,
proteinaceous polymer, polypeptide, polyester, or a naturally occurring polymer such
as starch, alginate, chitosan, and gelatin.
[0091] The microspheres can also include one or more stabilizer compounds (e.g., a carbohydrate,
a cationic compound, a pluronic, e.g., Pluronic-F68
™ (Sigma-Aldrich Co., St. Louis, MO), a lipid, or a DNA-condensing agent). A stabilizer
compound is a compound that acts to protect the nucleic acid (e.g., to keep it supercoiled
or protect it from degradation) at any time during the production of microspheres
or after
in vivo delivery. The stabilizer compound can remain associated with the DNA after a later
release from the polymeric delivery system.
[0092] Examples of stabilizer compounds include tris(hydroxymethyl)aminomethane (TRIS),
ethylenediaminetetraacetic acid (EDTA), or a combination of TRIS and EDTA (TE). Other
stabilizer compounds include dextrose, sucrose, lactose, dextran, trehalose, cyclodextrin,
dextran sulfate, cationic peptides, pluronics, e.g., Pluronic F-68
™ (Sigma-Aldrich Co., St. Louis, MO), and lipids such as hexadecyltrimethylammonium
bromide. Preparation of microspheres containing stabilizer agents is described in
USSN 09/266,463.
[0093] The lipid can be a charged lipid such as a cationic lipid, an anionic lipid (such
as PEG-DSPE, taurocholic acid or phosphatidyl inositol), or a zwitterionic lipid,
or may have no charge. Examples of lipids include cetyltrimethylammonium and phospholipids,
e.g., phosphatidylcholine. The microspheres may contain one or more than one type
of lipid, e.g., those lipids present in lecithin lipid preparations, and may also
include one or more stabilizer compounds as described above.
[0094] Microspheres can be used to maximize delivery of DNA molecules into a subject's phagocytotic
cells. Alternatively, the biodegradable microspheres can be injected or implanted
in a tissue, where they form a deposit. As the deposit breaks down, the nucleic acid
is released gradually over time and taken up by neighboring cells (including APCs)
as free DNA.
Delivery Using Other Agents
[0095] The polyepitope polypeptides, or nucleic acids encoding them, can also be administered
to subjects using other agents such as lipids, dendrimers, or liposomes, using techniques
that are well known in the art. For example, liposomes carrying either immunogenic
polypeptides or nucleic acids encoding immunogenic epitopes are known to elicit CTL
responses
in vivo (
Reddy et al., J. Immunol. 148:1585, 1992;
Collins et al., J. Immunol. 148:3336-3341, 1992;
Fries et al., Proc. Natl. Acad. Sci. (USA) 89:358, 1992;
Nabel et al., Proc. Natl. Acad. Sci. (USA) 89:5157, 1992).
[0096] The polypeptides and nucleic acids of the invention can also be administered by using
Immune Stimulating Complexes (ISCOMS), which are negatively charged, cage-like structures
30-40nm in size formed spontaneously on mixing cholesterol and Quil A (saponin), or
from saponin alone. The polypeptides and nucleic acids of the invention can be complexed
with ISCOMs, then administered, or can be administered separately.
[0097] Protective immunity has been generated in a variety of experimental models of infection,
including toxoplasmosis and Epstein-Barr virus-induced tumors, using ISCOMs as the
delivery vehicle for antigens (
Mowat et al., Immunology Today 12:383-385, 1991). Doses of antigen as low as 1µg encapsulated in ISCOMs have been found to produce
class I- mediated CTL responses, where either purified intact HIV-1-IIIB gp 160 envelope
glycoprotein or influenza hemagglutinin is the antigen (
Takahashi et al., Nature 344:873-875, 1990).
Measuring Immune Responses
[0098] The ability of polyepitope polypeptides, or nucleic acids encoding them, to elicit
an immune response in a host mammal can be assayed by using methods for measuring
immune responses that are well known in the art. For example, the generation of cytotoxic
T cells can be demonstrated in a standard
51Cr release assay, by measuring intracellular cytokine expression or secretion, or
by using MHC tetramers. Standard assays, such as ELISA or ELISPOT, can be used to
measure cytokine profiles attributable to T cell activation. T cell proliferation
can be measured using assays such as
3H-thymidine uptake and other assays known in the art. B cell responses can be measured
using art recognized assays such as ELISA.
[0099] Other methodologies, e.g., digital imaging and cytologic, colposcopic and histological
evaluations, can also be used to evaluate the effects of immunogenic epitopes, and
of nucleic acids encoding the immunogenic epitopes, on pathogen-associated lesions,
or on viral or other pathogen levels generally.
[0100] The following are examples of the practice of the invention. They are not to be construed
as limiting the scope of the invention in any way.
Example 1. Identification of HPV-derived MHC class I-binding epitopes
[0101] HLA alleles are isolated from cell lines which express a single HLA-A allotype. 10-20
liters of each cell line (about 1-2 × 10
11 cells) are grown in complete RPMI-1640 media (10% FCS, HEPES, Pen/Strep, essential
amino acids, glutamine) in roller bottles, and the cells harvested by centrifugation
(10-15 gm wet weight cells/10 L culture). A membrane preparation is generated by lysing
cells in 10 mM Tris, I mM DTT, 0.1 mM PMSF, for 30 min. Debris is pelleted, after
which the cleared lysate is homogenized in lysis buffer and again pelleted. The pellet
is homogenized in buffer containing 4% NP-40 and ultracentrifuged. The detergent-soluble
material is used for HLA purification.
[0102] The solubilized membrane preparation is pumped through pre-clearing columns (chromatographic
matrix and normal mouse serum-matrix) before the protein/ligand containing effluent
is directed towards one, or a series of, specific immunoaffinity column(s). Immunoaffinity
columns containing the pan anti-class I mAb W6/32 can be used to isolate class I molecules
from the single allotype-expressing cell lines. Alternatively, allotype-specific mAb
such as BB7.2 are used to extract a single HLA allotype (HLA-A2) from a cell lysate
that expresses multiple allotypes. Coupling of mAb to high strength, large throughpore
perfusion sorbents (coated and crosslinked with a hydrophilic stationary phase and
covalently attached to Protein A) can be utilized to allow for fast flowrates (up
to 20 ml/min). The immunoaffinity columns are then extensively washed and the protein/ligand
complex is eluted from the immunoaffinity support using 50 mM carbonate/0.1% DOC/0.05%
NaN
3 at pH 11.5.
[0103] Multi-modal high-performance liquid-chromatography (HPLC) separation of HLA molecules
is achieved by coupling the chromatographic procedures in series with automated switching
valves, which direct the protein/ligand-containing effluent to subsequent columns
in the sequence. Each column effluent can be monitored at multiple UV wavelengths,
pressure, and pH.
[0104] Purified HLA alleles are then used in epitope binding competition assays. Binding
by a putative epitope is compared to binding by previously described HLA-binding epitopes.
Examples of known epitopes and their respective allotypes include: HLA-A1, YLEPAIAKY
(SEQ ID NO: 117); HLA-A2, FLPSDYFPSV (SEQ ID NO:118); HLA-A3, KVFPYALINK (SEQ ID NO:119);
HLA-A11, AVDLYHFLK (SEQ ID NO:120); and HLA-A24, AYIDNYNKF (SEQ ID NO:121). General
assay conditions are as follows: class I proteins are incubated in 0.05% NP-40/PBS
with ∼5 nM of radiolabeled standard epitope and the test inhibitor epitope in presence
of 1 µM human β2microglobulin, and a mixture of protease inhibitors (final concentration
1 mM PMSF, 1.3 mM 1,10 phenanthroline, 73 µM pepstatin, 8 mM EDTA and 200 nM N-α-p-tosyl-L-lysine
chloromethyl ketone) at 23 °C for 48 h. The final concentration of each HLA allotype
is determined experimentally as explained below. Concentrations of inhibitor peptides
are titrated at concentration ranges from 1 nM to 100 µM.
[0105] Free and bound peptides are separated by HPLC size exclusion chromatography using
a TSK 2000
™ SEC column and 0.5% NP-40/PBS. The eluent is monitored for radioactivity and the
fraction of peptide bound to HLA relative to the total amount of offered peptide is
calculated from the ratio of peptide in the void volume to the total peptide recovered.
The final concentration of HLA-A1, -A2, -A3, -A11, and -A24 to be used in subsequent
binding assays must be determined experimentally based on the binding efficiency for
the radiolabeled standard peptide. The necessary protein concentration for inhibition
studies typically falls between 10-40 nM. Each allotype is tested for binding of the
radiolabeled peptide by performing serial dilutions of the protein concentration from
1 nM to 1 µM of the HLA molecule at the beginning of the screening.
[0106] The binding affinity of potential peptide epitopes to human leukocyte antigen (HLA)
receptors can be studied using a competitive binding assay (
Sette et al., Molecular Immunology 31:813-822, 1994). This assay requires (1) purified HLA receptors, (2) a synthetic peptide which binds
to the HLA receptor of interest and contains a tyrosine amino acid in a location which
can be labeled with radioactive iodine-125 without interrupting the peptide's ability
to bind, (3) purified beta-2-microglobulin (β
2m), and (4) synthetic peptide epitopes which are to be tested. The optimal experimental
HLA receptor concentrations are established by titrating the amount of HLA receptor
in each binding assay required to achieve at least 10% binding of the total labeled
peptide (fixed at 5nM) (β
2m concentration is also fixed at 1 µM). With these three parameters (concentration
of receptor, β
2m, and concentration of radiolabeled peptide) held constant, a titration of unlabeled
test peptide is performed. Each binding reaction is incubated at room temperature
for 30-80 h to allow for peptide exchange. The quantitation of the peptide exchange
is determined by separating the bound fraction of radiolabeled peptide/receptor complex
away from the excess free peptide and β
2m by size exclusion chromatography. Using an HPLC system fitted with a radioisotope
detector, the percentage of radiolabeled peptide bound to the HLA receptor can be
quantified. The ability of the unlabeled test peptide to inhibit the binding of the
labeled peptide is then plotted as a function of its concentration. The affinity of
the test peptide is presented as the concentration of test peptide required to inhibit
50% of the total binding of the radiolabeled peptide (a so-called IC-50 value).
[0107] Several peptides derived from the E6 and E7 proteins of the human papilloma virus
(HPV) strains 16 and 18 have been identified as high affinity, HLA-binding peptides
using this type of assay. In these experiments, HLA receptors A1 and A11 were purified
from human cells which had been transfected with HLA-A*0101 and HLA-A*1101 genes,
respectively (
Gorga et al., J. Biol. Chem. 262:16087-16094, 1987). In the case of HLA receptors A3 and A24, recombinant HLA receptors (HLA-A*0301
and HLA-A*2402) were used which had been produced in E. coli and refolded (
Garboczi et al., Proc. Natl. Acad. Sci. USA 89:3429-3433, 1992). Examples of experimental conditions and data collected are presented in Table 4.
TABLE 4
Sequence (amino acid) |
HLA Type |
Incubation (hours) |
IC-50 (nM) |
ISEYRHYCY (SEQ ID NO:70) |
A1 |
51 |
49 |
IVYRDGNPY (SEQ ID NO:83) |
A3 |
46 |
238 |
HTMLCMCCK (SEQ ID NO:122) |
A11 |
68 |
67 |
QLFLNTLSF (SEQ ID NO:123) |
A24 |
68 |
47 |
SLQDIEITCV (SEQ ID NO:130) |
A2 |
50.5 |
50 |
[0108] If desired, the predictive binding algorithm described above can be used to prioritize
putative epitopes according to dissociation times for each allele, with epitopes having
the longest dissociation time tested first. After 5-10 epitopes with reasonable affinities
for each of the dominant HLA-A alleles (i.e., < 500nM) are identified, testing can
be discontinued. If epitopes with less than 500nM binding affinity are not found,
then the 5-10 best binders from each protein can be selected for continued analysis.
Example 2. Detection of MHC class I-restricted epitope presentation in vitro
[0110] Peripheral blood mononuclear cells (PBMC) from normal volunteers are purified by
Ficoll-Paque
™ (Pharmacia, Piscataway, NJ) density centrifugation from leukophoresis products screened
as HIV, HBV, and HCV seronegative. Dendritic cells (DC) are generated in tissue culture
from monocyte-enriched PBMC fractions as described (
Tsai et al., Crit. Rev. Immunol. 18:65-75, 1998;
Wilson et al., J. Immunol. 162:3070-78, 1999). 10
7 PBMC/ml in serum-free RPMI 1640 medium (Gibco-BRL) are plated in flasks and incubated
1.5-2.0 hr at 37°C. Non-adherent cells are removed by gentle washes, and the plastic-adherent
monocytes containing DC precursors are cultured in complete medium in the presence
of 50 ng/ml GM-CSF and 1000 U/ml IL-4 (both from R&D Systems, Minneapolis, MN) for
6-7 days. Complete medium consists of RPMI 1640 supplemented with 5% pooled human
AB serum (C-6 Diagnostics, Mequon, WI), L-glutamine, penicillin/streptomycin, 2-ME
(Gibco-BRL, Gaithersburg, MD) and HEPES (JRH Biosciences, Lenexa, KS) at the recommended
concentrations.
[0111] Non-adherent cells are collected by centrifugation and prepared directly for use
as APC or cryopreserved. Cells are determined to be DC by morphology and by expression
of a CD3/CD16-negative, MHC class I
hi, MHC class II
hi, CD86-positive phenotype as assessed by cytofluorimetry.
[0112] At Day 0, 5x10
5 non-adherent PBL are plated with 2.5x10
4 irradiated, epitope-pulsed DC. The DC are in 48 well plates in 0.5 ml complete RPMI-1640
with 10% normal human AB serum supplemented with 10 ng/ml IL-7. The DC are incubated
with the PBL at 37°C in a CO
2 incubator. 10 ng/ml IL-10 is added 24 h later. On day 7, autologous PBL are thawed
and irradiated. 1x10
6 cells per well are plated in a 48 well plate and allowed to adhere for 2 h. Epitopes
are added, and cells are pulsed for 2 h. Cells are washed once, and responders transferred
into wells with adherent stimulators. 10 ng/ml IL-10 is added 24 h later. 20 U IL-2/ml
are added on day 9 and 100 U/ml IL-2 on day 11. Cells are restimulated on day 15 in
the same fashion. On day 22, the cells in 1-2 wells of each individual culture are
harvested and counted. Responders are those cells that have increased cell number
1.5-3 fold over day 16 input. The total culture yields generally should be at least
2x10
6 cells.
[0113] Cells to be used as targets are harvested and adjusted to 6.67x10
5 cells/ml in medium. Two mls of cells are pulsed with 50 ug/ml of each of the appropriate
epitopes (e.g., Flu M1, Test #1, Test #2, Test #3, Test #4). Effectors are harvested
and resuspended at 1x10
6 cells/ml in medium. 100 µl is plated into each well of a round bottom 96-well plate.
150 µl of each respective target cell is aliquotted to the well containing the appropriate
effector cells for a total volume of 250 µl/well. Plates are incubated for 24 h in
an humidified 37°C CO
2 incubator.
[0114] ENDOGEN (Woburn, MA) human IFNγ ELISA kits are used to measure IFNγ secretion. The
assay is performed according to manufacturer's directions, and supernatants are tested
in duplicate. IFN-γ standards of 1000 pg/ml, 400 pg/ml, 160 pg/ml, 64 pg/ml, 25.6
pg/ml, and 0 pg/ml are tested in duplicate. The assay plate is read on a Molecular
Devices Kinetic Microplate Reader and the results analyzed with Vmax Plate Reader/SOFTMAX™
software.
[0115] T2A2 cells are suitable targets when testing the HPV 16 and 18 E6 and E7 epitopes
in the T cell assay (the HPV 2.4-C peptide (SEQ ID NO:61) is included as an example
of an HLA-A2 binding HPV epitope to be tested in this way). However, when testing
other allotypes (e.g., HLA-A1, -A3, -A11 and -A24), T2A2 cells are not appropriate
APCs, and the FluM1 epitope is not an appropriate positive control epitope. Appropriate
targets are autologous EBV-transformed cells or PBL. Appropriate control recall epitopes
for these other allotypes include the following: HLA-A1, Flu NP 44-52; HLA-A3, Flu
NP 265-273; HLA-A11, EBNA3 603-611 and EBNA4 416-424; HLA-A24, EBV LMP 419-427. Suitable
in vitro immunization controls include HLA-A1, MAGE- 61-69; HLA-A2, HBVpol 455-463; HLA-A3,
P.
falciparum LSA- 94-102; HLA-A11, HIV gag 325-333; and HLA-A24, HIV gp41 584-591.
Example 3. Generation of primary peptide-specific cytotoxic T-lymphocytes in vitro
using peptide-pulsed autologous dendritic cells
[0116] The effectiveness of various HPV-derived peptides in generating CTL responses
in vitro was determined by co-culturing peptide-pulsed dendritic cells (DC) with peripheral
blood mononuclear cells (PBMC) from donors having defined HLA allotypes. The tested
peptides included peptides having amino acids sequences corresponding to the following
HPV protein amino acid sequences: HPV strain 16 E7 89-97 (SEQ ID NO:96); HPV strain
16 E6 92-101 (SEQ ID NO:77); HPV strain 18 E7 59-67 (SEQ ID NO: 122); HPV strain 18
E6 13-21 (SEQ ID NO: 124), and HPV strain 18 E6 97-106 (SEQ ID NO:125).
[0117] Primary T cell responses were initiated using a modification of published protocols
(
Tsai et al., Crit. Rev. Immunol. 18:65-75, 1998;
Wilson et al., J. Immunol. 162:3070-78, 1999). Peripheral blood mononuclear cells (PBMC) were purified from leukophoreis products
from HLA-A-defined normal donors who screened as seronegative for human immunodeficiency
virus and hepatitis B virus. Dendritic cells (DC) were pulsed for 2 h at 20°C with
20 µg/ml peptides in phosphate buffered saline supplemented with 3 µg/ml β2 microglobulin
and were irradiated (3000 rad) before use. 2x10
5 peptide-pulsed and washed DC were co-cultured with 2x10
6 autologous non-adherent PBMC in 24-well culture plates in the presence of 10 ng/ml
IL-7. One day later, cultures were supplemented with 10 ng/ml IL-10. On days 7 and
14, individual cultures were restimulated by transfer of non-adherent PBMC responder
cells onto autologous irradiated monocytes pulsed with 20 µg/ml peptide as described
above. 10 ng/ml IL-10 and 100 U/ml IL-2 were added 1 and 2 days, respectively, after
each restimulation cycle.
[0118] The immune reactivity of the PBMC cultures was assessed by the ability to elicit
specific IFN-γ secretion from day 21 peptide-sensitized cultures following their incubation
with antigen presenting cells pulsed with either the immunizing peptide or an irrelevant
antigenic peptide that specifically bound the same targeted HLA class I molecule.
10
5 effector cells were incubated with 10
5 autologous, irradiated peptide-pulsed PBMC for 24 h at 37°C in 200 µl complete medium.
Supernatants from these cultures were measured for IFN-γ secretion using a commercial
ELISA assay. The results are shown in Table 5. Data are presented as picograms of
IFN-γ/ml. Specific reactivity by a PBMC culture was arbitrarily defined as at least
20 pg/ml per assay culture and a 1.5-fold or higher difference in IFN-γ secretion
in response to the test peptide-pulsed versus the irrelevant peptide-pulsed stimulator
cells. FluM1 58-66 and the EBNA4 416-424 CTL peptide epitopes were used as A2 and
A11 irrelevant controls, respectively.
Table 5: In vitro induction of primary, peptide-specific cytotoxic T-lymphocytes using peptide-pulsed
dendritic cells
|
|
IFN-γ release (pg/ml) |
PBMC donor / HLA type |
In vitro sensitization/ expansion with peptide |
Stimulator cells pulsed with |
irrelevant peptide |
test peptide |
P5 /HLA-A11, A31 |
A11 / HIV gag 325-333 |
634 |
1166 |
P8 / HLA-A2, A28 |
A2 / HBV pol 455-463 |
96 |
1824 |
P5/ HLA-A11 , A3 1 |
16E7 89-97 |
41 |
1275 |
|
16E6 92-101 |
38 |
259 |
|
18E7 59-67 |
262 |
665 |
P8 / HLA-A2, A28 |
18E6 13-21 |
61 |
1590 |
|
18E6 97-106 |
77 |
1352 |
Specific reactivity against HPV 16 and 18 E6 and E7 peptides by CTL induced with peptide-pulsed
dendritic cells. |
Example 4. Generation of a nucleic acid encoding a polyepitope polypeptide
[0119] Once candidate epitopes are identified, a DNA fragment is generated that encodes
the epitopes of interest. Sequences encoding the epitopes are generated by overlapping
PCR or by ligating oligonucleotides. Regulatory elements including a promoter, a Kozak
sequence, an initiating ATG, a stop codon, an intron and polyadenylation sequences
are included in the construct.
[0120] A T7 polymerase promoter is also present at the 5' end of the coding sequence, and
a sequence encoding a FLAG mAb (or other) determinant can be present either directly
5' of the first epitope coding sequence or 3' of the last epitope coding sequence.
Constructs with and without a targeting signal (e.g., a leader peptide or endosomal/class
II loading vesicle targeting sequence) are created. The -3, -1 rules of von
Heijne (Nuc. Acids Res. 14:4683-4690, 1986) are followed to ensure the probability of successful cleavage by signal peptidase
when the leader is present.
[0121] The PCR fragment is cloned into a TA vector (Invitrogen) which permits direct and
rapid cloning of PCR products. The construct is sequenced and, if mistakes have been
incorporated, the PCR is repeated under more stringent or otherwise optimized conditions.
The PCR clone, or alternatively the DNA produced by ligation of oligonucleotides,
is then cloned into a mammalian expression vector such as p3K or pcDNA (Invitrogen).
In addition, the fragment is cloned into a vaccinia vector (such as pSC11) for generation
of recombinant vaccinia virus (see below) and a bacterial expression vector (such
as pGEX-5x (Pharmacia)) that permits expression of a GST fusion protein of the polyepitope
polypeptide yeast or baculovirus expression vector.
In vitro transcription/translation (Promega T7 TNT coupled transcription/translation kits)
is performed according to the manufacturer's instructions. The translated protein,
when analyzed by SDS-PAGE and autoradiography, has been shown to produce a polypeptide
of the expected size.
Example 5. Identification of processed epitopes from polyepitope proteins
[0122] The T cell stimulation assay described in Example 2 is used to determine which epitopes
are processed from the polyepitope polypeptide encoded by the construct. Effectors
generated from PBL stimulated
in vitro with each of the epitopes encoded in the construct are tested for γIFN secretion
when incubated with the appropriate targets. Targets can be autologous PBL cells or
EBV-transformed cells infected with a recombinant vaccinia virus that encodes the
polyepitope polypeptide (with and without the leader). Processing of the polyepitope
polypeptide liberates the T cell epitopes, which are subsequently presented on the
surface of the target cells.
[0123] Recombinant vaccinia was produced by standard procedures by inserting the polyepitope
polypeptide-encoding construct into the SmaI site of the pSC11 vector (
Chakrabarti et al., Mol. Cell. Biol. 5:3403-09, 1985) and then generating recombinant vaccinia by methods known in the art.
[0124] To determine if the encoded polyepitope polypeptide is processed and the expected
epitopes are presented by HLA molecules, the
in vitro stimulation assay may be performed as described in Example 2, with the exception
that the targets are autologous EBV-transformed APCs infected with the recombinant
vaccinia virus that contains the polyepitope coding sequences. In the experiment illustrated
in Fig. 3, EBV-transformed APCs from a donor were infected with recombinant vaccinia
virus encoding the test peptide 16E7 44-52, at a m.o.i. of 5 pfu. Control cells were
infected with wildtype vaccinia virus. The cells were incubated with the virus for
2.5 h in the presence of
51Cr. Following washing, the vaccinia-infected target cells were contacted for 5 h with
autologous T cells previously activated with 16E7 44-52.
51Cr release into supernatant was taken as a measure of target cell lysis by the effector
cells. As shown in Fig. 3, target cells infected with a vaccinia vector encoding the
test peptide were more efficiently lysed by the effector cells than were the control
target cells, suggesting that the peptide was expressed within the cells and effectively
presented by the cells' HLA molecules.
[0125] Targets can instead be autologous PBL infected with the recombinant virus, or 7221
cells expressing a single HLA and which are transfected with the p3k or pcDNA construct
(or any other mammalian expression vector) encoding the polyepitope polypeptide.
[0126] HLA-A2 transgenic animals may be used to verify that the construct functions to generate
HLA-A2 epitopes when delivered
in vivo. The polyepitope polypeptide-encoding construct in the mammalian expression vector
is encapsulated in microparticles. They are injected into HLA-A2 transgenic mice,
and T cell responses are subsequently examined as previously described (
Hedley et al., Nature Med. 4:365-68, 1998). Alternatively, the expression vector can be delivered as naked DNA. Target cells
are HLA-2 expressing cells (e.g., T2A2 or EL4-A2 cells) pulsed with the HLA-A2 binding-epitope
being tested, and similar cells infected with the polyepitope-encoding vaccinia vector.
In this way, HLA-A2 epitopes that are processed and presented
in vivo following administration of the construct are identified. Positive results indicate
that processing of the polyepitope polypeptide is occurring as predicted, though do
not distinguish between epitopes presented by the mouse's endogenous murine MHC molecules
and those presented by the transgene-derived HLA-A2 molecules. Immunization of the
transgenic mice with a plasmid encoding a polyepitope polypeptide containing a number
of HPV-derived epitopes, some of which are known to bind HLA-A2 and at least one of
which is known to bind to an endogenous murine MHC molecule, was shown to produce
an immune response against two epitopes, including the one known to bind to the murine
MHC molecule.
Example 6: CTL responses generated in DNA-immunized HLA-A2 transgenic mice
[0127] CTL responses were measured in mice immunized with microsphere-encapsulated DNA encoding
a polyepitope polypeptide. The DNA used for immunization was designated HPV Dra 16/18
(nucleotide sequence of SEQ ID NO:1 62, encoding the polypeptide of SEQ ID NO: 160).
Effector cells generated in the DNA immunized mice were tested
in vitro for their responsiveness in the presence of target cells infected with a vaccinia
virus encoding a polyepitope polypeptide. Two polyepitope constructs were separately
evaluated in target cells: (1) HPV Dra 16/18 (amino acid sequence of SEQ ID NO: 160;
nucleotide sequence of SEQ ID NO: 162); and (2) HPV 16/18(amino acid sequence of SEQ
ID NO:158; nucleotide sequence of SEQ ID NO:161).
[0128] Transgenic HLA-A *0201/H-2K
b line 6 mice (C57BL/6 x BIO.D2) originated from the breeding colony at the Research
Institute of Scripps Clinic and were maintained under clean conventional conditions.
HLA-A *0201/H-2K
b transgenic mice were injected intramuscularly in the hind limbs with 30 µg PEG-DSPE
microsphere encapsulated p3KHPVDra 16/18 DNA. The mice were boosted on days 30 and
48 with 50 µg PEG-DSPE encapsulated p3KHPVDra 16/18 DNA.
[0129] On day 64, the mice were sacrificed and their spleens harvested. A single cell suspension
was prepared, cells pooled, red blood cells lysed, and CD3+ enriched cell population
obtained using an immuno-affinity column (R&D Systems, Minneapolis, MN). Spleens cells
were restimulated
in vitro with three day old syngeneic irradiated lipopolysaccharide (LPS)-stimulated B cell
blasts (ratio 1:1) which had been preincubated for two hours at 37°C with 100 µM peptide
in RPMI 1610 (JRH Biosciences, Lenexa, KS). Peptides used for
in vitro expansion were: (1) HPV16E648-56 (peptide 124; EVYDFAFRD; SEQ ID NO:163); and (2)
HPV16E786-93 (peptide 272; TLGIVCPI; SEQ ID NO:61). Peptides were dissolved in 100%
DMSO to 20 mg/ml and stored at -20°C until use. In each well of a 6-well plate 10
5 effectors were plated in RPMI 1610 supplemented with 10% fetal bovine serum (JRH
Biosciences, Lenexa, KS), antibiotics (50 IU/ml penicillin and 50 µg/ml streptomycin),
HEPES (JRH Biosciences, Lenexa, KS), 30 µM 2-ME (Gibco-BRL, Gaithersburg, MD) with
final peptide concentration of 10 µM. On day 65, 10 IU/ml mIL-2 was added. Effectors
were harvested on day 71 and assayed for peptide specific responses by measuring IFN-γ
release in an ELISPOT assay, as described below.
[0130] The target cell line used in these experiments, an EL4 HLA-A2/H-2K
b cell line, was generated by transfecting EL4 cells (C57BL/6 thymoma, H-2
b) with a pSV2 plasmid containing the chimeric construct HLA-A2.1 (α
1 and α
2 domain)/H-2K
b (α
3 domain) and cotransfecting with the pSV2 neo plasmid containing the neomycin resistance
gene.
[0131] Two recombinant vaccinia vectors (rVac), Vac HPV Dra 16/18 and Vac HPV 16/18, were
generated by the insertion of either pSC11HPV Dra 16/18 or pSC11HPV 16/18 constructs
into the thymidine kinase gene of wild type vaccinia virus (a TC-adapted Western Reserve
strain; ATCC #VR1354). The resulting recombinant virus underwent three cycles of screening
using dual selection with BrdU (inactivation of thymidine kinase activity) and X-gal
(pSC11LacZ activity) in host cells with a TK
- phenotype (143B, ATCC CRL-8303). Infected targets (EL4 HLA-A2/H-2K
b cells) were generated with 10 MOI rVac at 37°C for six hours.
[0132] A commercially prepared murine IFN-γ ELISPOT kit (R&D Systems, Minneapolis, MN) was
utilized as per the manufacturer's suggested protocol. Each well of a 96-well hydrophobic
polyvinylidene flouride (PVDF) membrane backed plate was pre-absorbed with anti-IFN-γ
monoclonal antibody (mAb) and blocked with 10% RPMI for 20 minutes. Approximately
10
4-10
5 effectors were then mixed with 10
5 targets (vaccinia infected EL4 HLA-A2/H-2K
b cells) for 18-20 hours at 37°C in 5% CO
2. Next, each well was washed four times and incubated overnight at 4°C with a biotinylated
non-competing anti-IFN-γ mAb. Wells were then washed three times, incubated for two
hours at room temperature with streptavidin alkaline-phosphatase, washed again three
times and developed with a 30 minute incubation with BCIP/NBT and washed extensively
with distilled water. IFN-γ secreting cells (spots) were enumerated on an automated
ELISPOT reader system (Carl Zeiss Inc., Thornwood, NY) with KS ELISPOT Software 4.2
by Zellnet Consulting, Inc. (New York, NY).
[0133] As shown if Figure 6, immunization of mice with DNA encoding an HPV polyepitope construct
elicited peptide specific CTLs. Data are presented as the measurement of IFN-γ
+ spots and represent the antigen specific response per million CD3
+ cells.
Example 7: CTL responses in fresh spleen cells from mice treated with DNA encoding
a polyepitope polypeptide
[0134] Transgenic HLA-A *0201/H-2K
b mice (described in Example 6) were sequentially subjected to: (1) an injection of
microsphere-encapsulated DNA encoding a polyepitope polypeptide; and (2) an infection
with vaccinia virus encoding the polyepitope polypeptide. The IFN-γ ELISPOT assay
described in Example 6 was used to detect and enumerate T cells specific for DNA-encoded
CTL epitopes in fresh, unexpanded spleen cells.
[0135] The treatment regimen was as follows (see Table 6). Ten week old mice were injected
with PEG/DSPE microspheres containing 100g of DNA. Twenty-six days after the microsphere
injection, mice were infected intraperitoneally with 1x10
7 plaque forming units of vaccinia virus encoding the same polyepitope polypeptide.
Table 6: Vaccination Schedule and Immunization Regimen
Experimental Group |
Number of Mice |
Intramuscular DNA/microsphere injection |
Vaccinia Boost |
Intraperitoneal Virus dose |
Untreated |
5 |
none |
none |
none |
Group 1 |
5 |
pBKCMV |
Vac wild type |
1x107 PFU/0.1ml |
Group 2 |
5 |
p3KDRaHPV1618 |
VacDRα16-18 |
1x107 PFU/0.1ml |
[0136] Nine days after the vaccinia boost, spleens were harvested, CD3+ T-cells were enriched
(T-cell enrichment columns; R&D Systems, Minneapolis, MN), and peptide-specific IFN-γ
release was detected using murine IFN-γ ELISPOT (R&D Systems, Minneapolis, MN). For
each antigenic treatment, five wells of 2.5x10
5 T-enriched spleen cells were co-incubated with 2x10
5 EL4-A2/K
b stimulator cells that were either untreated or pre-pulsed with defined class I peptide
epitopes. As controls, spleen cells were also incubated with stimulators either: (1)
infected with 20mol of vaccinia wild type virus; or (2) treated with 25 ug Con A/ml.
Plates were incubated at 37°C in 10% CO
2 for 48 hours and then developed for IFN-γ detection. HPV-specific IFN-γ responses
were reported as the number of spot-forming cells (SFC)/1x10
6 input T-enriched splenocytes. (the absolute numbers of SFCs are shown in Table 7).
The background rate of IFN-γ secretion was defined as SFC/1x10
6 input T-enriched splenocytes incubated with stimulator cells pulsed with irrelevant
peptide (HLA-A2-restricted Plasmodium falciparum cp36 epitope; lot #322). HPV peptide-specific
responses were considered positive if twice the background. The frequency of cp36-specific
SFC /1x10
6 cells was 0, 0, and 12 for Groups 0, 1, and 2, respectively.
Table 7: IFN-γ Responses in Freshly Isolated Spleen Cells
Prime |
Boost |
HPV16 E648-56 |
HPV16 E679-87 |
HPV16 E749-57 |
HPV16 E624-32 |
HPV16 E77-15 |
p3KDRa HPV1618 |
VacHPVDrα 1618 |
124 |
37 |
73 |
24 |
34 |
Vector |
Vac wildtype |
14 |
10 |
2 |
5 |
16 |
Untreated |
none |
6 |
6 |
2 |
0 |
10 |
Other Embodiments
[0137] While the invention has been described in conjunction with the detailed description
thereof, the foregoing description is intended to illustrate and not limit the scope
of the invention, which is defined by the scope of the appended claims.