FIELD OF THE INVENTION
[0001] This invention relates to modified peptides that are inhibitors of viral activity
and/or exhibit antifusogenic properties. In particular, this invention relates to
modified peptide inhibitors of human immunodeficiency virus (HIV), respiratory syncytial
virus (RSV), human parainfluenza virus (HPV), measles virus (MeV), and simian immunodeficiency
virus (SIV) with long duration of action for the treatment of the respective viral
infections. The invention also relates to conjugates of the modified peptides and
endogenous carriers, particularly conjugates of the modified peptides and various
mobile blood components, particularly mobile endogenous proteins.
BACKGROUND OF THE INVENTION
[0002] Membrane fusion events, while commonplace in normal cell biological processes, are
also involved in a variety of disease states, including, for example the entry of
enveloped viruses into cells. Peptides are known that inhibit or otherwise disrupt
membrane fusion-associated events, including, for example, inhibiting retroviral transmission
to uninfected cells. As an example, the synthetic peptides DP-107 and DP-178 derived
from separate domains within the human immunodeficiency virus type 1 ("HIV-1") transmembrane
("TM") glycoprotein gp41, are potent inhibitors of HIV-1 infection and HIV induced
cell-cell fusion.
[0003] Lambert, et al., "Peptides from Conserved Regions of Paramyxovirus Fusion (F) Proteins
are Potent Inhibitors of Viral Fusion," Proc. Natl. Acad. Science U.S.A., March 5,
1996, Vol. 93 (5), pp. 2186-91, discloses that the synthetic peptides DP-107 and DP-178
(T-20), derived from separate domains within the human immunodeficiency virus type
1 (HIV-1) transmembrane (TM) protein, gp41, are potent inhibitors of HIV-1 infection
and fusion. Using a computer searching strategy (computerized antiviral searching
technology, C.A.S.T.) based on the predicted secondary structure of DP-107 and DP-178
(T-20), Lambert, et al. identified conserved heptad repeat domains analogous to the
DP-107 and DP-178 regions of HIV-1 gp41 within the glycoproteins of other fusogenic
viruses. Antiviral peptides derived from three representative paramyxoviruses, respiratory
syncytial virus (RSV), human parainfluenza virus type 3 (HPIV-3), and measles virus
(MV) blocked homologous virus-mediated syncytium formation and exhibited EC
50 values in the range 0.015-0.250 µM. Moreover, these peptides were highly selective
for the virus of origin.
[0004] U.S. Patent Nos. 6,013,263, 6,017,536 and 6,020,459 incorporated herein in their
entirety, likewise disclose that the 36 amino acid peptide DP178 corresponding to
amino acids 638 to 673 of gp41 from the HIV-1 isolate LAI (HIV-1
LAI), and the 38 amino acid peptide DP107 corresponding to amino acids 558-595 of gp41
from the HIV-1
LAI, both exhibit potent anti-HIV-1 activity.
[0005] While many of the anti-viral or anti-fusogenic peptides described in the art exhibit
potent anti-viral and/or anti-fusogenic activity, these peptides suffer from short
plasma half-lifes
in vivo, primarily due to rapid serum clearance and peptidase and protease activity. This
in turn greatly reduces the effective anti-viral activity of the peptides. There is
therefore a need for a method of prolonging the half-life of existing anti-viral and/or
anti-fusogenic peptides and providing for longer duration of action of these peptides
in vivo.
SUMMARY OF THE INVENTION
[0006] The present invention meets these and other needs and is directed to modified peptides
having anti-viral activity and/or anti-fusogenic activity. These modified peptides
provide for an increased stability
in vivo and a reduced susceptibility to peptidase or protease degradation. These modified
peptides thereby minimize, e.g., the need for more frequent, or even continual, administration
of the peptides. The products of varying embodiments of the present invention can
be used, e.g., as a prophylactic against and/or treatment for infection of a number
of viruses, including human immunodeficiency virus (HIV), human respiratory syncytial
virus (RSV), human parainfluenza virus (HPV), measles virus (MeV) and simian immunodeficiency
virus (SIV). Modification of other peptides involved in viral transfection (e.g.,
Hepatitis, Epstein Barr and other related viruses) is also within the scope of the
invention.
[0007] This invention relates to chemically reactive modifications of peptides exhibiting
anti-viral and/or anti-fusogenic activity such that the modified peptides can react
with available functionalities on blood components to form stable covalent bonds.
In one embodiment of the invention, the modified peptides comprise a reactive group
which is reactive with amino groups, hydroxyl groups, or thiol groups on blood components
to form stable covalent bonds. In another embodiment of the invention, the reactive
group can be a maleimide which is reactive with a thiol group on a blood protein,
including a mobile blood protein such as albumin.
[0008] In particular, the invention relates to such chemically reactive modifications of
DP107 and DP178 peptides and analogs thereof, including peptides comprised of amino
acid sequences from other (non-HIV) viruses that correspond to the gp41 region of
HIV from which DP107 and DP178 are derived and that exhibit anti-viral or anti-fusogenic
activity. More particularly, these peptides can exhibit anti-viral activity against,
among others, human respiratory syncytial virus (RSV), human parainfluenza virus (HPV),
measles virus (MeV) and simian immunodeficiency virus (SIV). The invention also relates
to such chemically reactive modifications of the peptides of SEQ ID NO:1 to SEQ ID
NO:86.
[0009] The invention also relates to compositions for use in the prevention and/or treatment
of viral infection comprising a peptide that exhibits anti-viral activity modified
with a reactive group as described. More particularly, the invention relates to such
compositions for use in the prevention and/or treatement of AIDS, human respiratory
syncytial virus (RSV), human parainfluenza virus (HPV), measles virus (MeV) and simian
immunodeficiency virus (SIV).
BRIEF DESCRIPTION OF THE TABLES
[0010] The invention will be better understood by reference to the Tables, in which:
Table 1 lists the commonly occurring amino acids together with their one letter and
three letter abbreviations, and common protecting groups.
Table 2 shows DP178 carboxy truncations.
Table 3 shows DP178 amino truncations.
Table 4 shows DP107 carboxy truncations.
Table 5 shows DP107 amino truncations.
Table 6 shows HIV-2NIHZ DP178 analog carboxy truncations.
Table 7 shows HIV-2NIHZ DP178 analog amino truncations.
Table 8 shows RSV F2 region DP107 analog carboxy truncations.
Table 9 shows RSV F2 region DP107 analog amino truncations.
Table 10 shows RSV F1 region DP178 analog carboxy truncations.
Table 11 shows RSV F1 region DP178 analog amino truncations.
Table 12 shows HPV3 F1 region DP178 analog carboxy truncations.
Table 13 shows HPV3 F1 region DP178 analog amino truncations.
Table 14 shows HPV3 F1 region DP107 analog carboxy truncations.
Table 15 shows HPV3 F1 region DP107 analog amino truncations.
Table 16 shows representative anti-RSV peptides.
Table 17 shows representative anti-HPV3 peptides.
Table 18 shows representative anti-SIV peptides.
Table 19 shows representative anti-MeV peptides.
BRIEF DESCRIPTION OF SEQUENCE LISTING
[0011] The invention will be better understood by reference to the Sequence Listing, in
which:
SEQ ID NO:1 shows the peptide sequence of DP178.
SEQ ID NO:2 shows the peptide sequence of DP107
SEQ ID NO:3-9 show peptide sequences of certain DP178 analogs.
SEQ ID NO:10-30 show the peptide sequences of RSV F1 region and F2 region corresponding
to DP178 and DP107, and representtive anti-RSV peptides;
SEQ ID NO:31-62 show the peptide sequences of HPIV3 F1 region corresponding to DP178
and DP107, and representative anti-HPIV3 peptides;
SEQ ID NO:63-73 show peptide sequences of SIV corresponding to DP178 and representative
anti-SIV peptides; and
SEQ ID NO:74-78 show peptide sequences of MeV corresponding to DP178 and representative
anti-MeV peptides.
DETAILED DESCRIPTION OF THE INVENTION
[0012] To ensure a complete understanding of the invention the following definitions are
provided:
[0013] Anti-viral peptides: As used herein, anti-viral peptides shall refer to peptides that inhibit viral infection
of cells, by, for example, inhibiting cell-cell fusion or free virus infection. The
route of infection may involve membrane fusion, as occurs in the case of enveloped
viruses, or some other fusion event involving viral and cellular structures. Peptides
that inhibit viral infection by a particular virus may be referenced with respect
to that particular virus, e.g., anti-HIV peptide, anti-RSV peptide, etc.
[0014] Antifusogenic peptides: Antifusogenic peptides are peptides demonstrating an ability to inhibit or reduce
the level of membrane fusion events between two or more entities, e.g., virus-cell
or cell-cell, relative to the level of membrane fusion that occurs in the absence
of the peptide.
[0015] HIV and anti-HIV peptides: The human immunodeficiency virus (HIV), which is responsible for acquired immune
deficiency syndrome (AIDS), is a member of the lentivirus family of retroviruses.
There are two prevalent types of HIV, HIV-1 and HIV-2, with various strain of each
having been identified. HIV targets CD-4+ cells, and viral entry depends on binding
of the HIV protein gp41 to CD-4+ cell surface receptors. Anti-HIV peptides refer to
peptides that exhibit anti-viral activity against HIV, including inhibiting CD-4+
cell infection by free virus and/or inhibiting HIV-induced syncytia formation between
infected and uninfected CD-4+ cells.
[0016] SIV and anti-SIV peptides: Simian immunodeficiency viruses (SIV) are lentiviruses that cause acquired immunodeficiency
syndrome (AIDS)-like illnesses in susceptible monkeys. Anti-SIV peptides are peptides
that exhibit anti-viral activity against SIV, including inhibiting of infection of
cells by the SIV virus and inhibiting syncytia formation between infected and uninfected
cells.
[0017] RSV and anti-RSV peptides: Respiratory syncytial virus (RSV) is a respiratory pathogen, especially dangerous
in infants and small children where it can cause bronchiolitis (inflammation of the
small air passages) and pneumonia. RSVs are negative sense, single stranded RNA viruses
and are members of the
Paramyxoviridae family of viruses. The route of infection of RSV is typically through the mucous
membranes by the respiratory tract, i.e., nose, throat, windpipe and bronchi and bronchioles.
Anti-RSV peptides are peptides that exhibit anti-viral activity against RSV, including
inhibiting mucous membrane cell infection by free RSV virus and syncytia formation
between infection and uninfected cells.
[0018] HPV and anti-HPV peptides: Human parainfluenza virus (HPIV or HPV), like RSV, is another leading cause of respiratory
tract disease, and like RSVs, are negative sense, single stranded RNA viruses that
are members of the
Paramyxoviridae family of viruses. There are four recognized serotypes of HPIV -- HPIV-1, HPIV-2,
HPIV-3 and HPIV-4. HPIV-1 is the leading cause of croup in children, and both HPIV-1
and HPIV-2 cause upper and lower respiratory tract illnesses. HPIV-3 is more often
associated with bronchiolitis and pneumonia. Anti-HPV peptides are peptides that exhibit
anti-viral activity against HPV, including inhibiting infection by free HPV virus
and syncytia formation between infected and uninfected cells.
[0019] MeV and anti-Mev peptides: Measles virus (VM or MeV) is an enveloped negative, single-stranded RNA virus belonging
to the
Paramyxoviridae family of viruses. Like RSV and HPV, MeV causes respiratory disease, and also produces
an immuno-suppression responsible for additional, opportunistic infections. In some
cases, MeV can establish infection of the brain leading to severe neurlogical complications.
Anti-MeV peptides are peptides that exhibit anti-viral activity against MeV, including
inhibiting infection by free MeV virus and syncytia formation between infected and
uninfected cells.
[0020] DP-178 and DP178 analogs: Unless otherwise indicated explicitly or by context, DP-178 means the 36 amino acid
DP-178 peptide corresponding to amino acid residues 638-673 of the gp41 glycoprotein
of HIV-1 isolate LAI (HIV
LAI) and having the sequence:

as well as truncations, deletions and/or insertions thereof. Truncations of the DP178
peptide may comprise peptides of between 3-36 amino acids. Deletions consist of the
removal of one or more amino acid residues from the DP178 peptide, and may involve
the removal of a single contiguous portion of the peptide sequence or multiple portions.
Insertions may comprise single amino acid residues or stretches of residues and may
be made at the carboxy or amino terminal end of the DP178 peptide or at a position
internal to the peptide.
[0021] DP178 peptide analogs are peptides whose amino acid sequences are comprised of the
amino acid sequences of peptide regions of viruses other than HIV-1
LAI that correspond to the gp41 region from which DP178 was derived, as well as an truncations,
deletions or insertions thereof. Such other viruses may include, but are not limited
to, other HIV isolates such as HIV-2
NIHZ, respiratory syncytial virus (RSV), human parainfluenza virus (HPV), simian immunodeficiency
virus (SIV), and measles virus (MeV). DP178 analogs also refer to those peptide sequences
identified or recognized by the ALLMOTI5, 107x178x4 and PLZIP search motifs described
in U.S. Patent Nos. 6,013,263, 6,017,536 and 6,020,459 and incorporated herein, having
structural and/or amino acid motif similarity to DP178. DP178 analogs further refer
to peptides described as "DP178-like" as that term is defined in U.S. Patent Nos.
6,013,263, 6,017,536 and 6,020,459.
[0022] DP-107 and DP107 analogs: Unless otherwise indicated explicitly or by context, DP-107 means the 38 amino acid
DP-107 peptide corresponding to amino acid residues 558-595 of the gp41 protein of
HIV-1 isolate LAI (HIV
LAI) and having the sequence:

as well as truncations, deletions and/or insertions thereof. Truncations of the DP107
peptide may comprise peptides of between 3-38 amino acids. Deletions consist of the
removal of one or more amino acid residues from the DP107 peptide, and may involve
the removal of a single contiguous portion of the peptide sequence or multiple portions.
Insertions may comprise single amino acid residues or stretches of residues and may
be made at the carboxy or amino terminal end of the DP107 peptide or at a position
internal to the peptide.
[0023] DP107 peptide analogs are peptides whose amino acid sequences are comprised of the
amino acid sequences of peptide regions of viruses other than HIV-1
LAI that correspond to the gp41 region from which DP107 was derived, as well as truncations,
deletions and/or insertions thereof. Such other viruses may include, but are not limited
to, other HIV isolates such as HIV-2
NIHZ, respiratory syncytial virus (RSV), human parainfluenza virus (HPV), simian immunodeficiency
virus (SIV), and measles virus (MeV). DP107 analogs also refer to those peptide sequences
identified or recognized by the ALLMOTI5, 107x178x4 and PLZIP search motifs described
in U.S. Patent Nos. 6,013,263, 6,017,536 and 6,020,459 and incorporated herein, having
structural and/or amino acid motif similarity to DP107. DP107 analogs further refer
to peptides described as "DP107-like" as that term is defined in U.S. Patent Nos.
6,013,263, 6,017,536 and 6,020,459.
[0024] Reactive Groups: Reactive groups are chemical groups capable of forming a covalent bond. Such reactive
groups are coupled or bonded to a DP-107 or DP-178 peptide or analogs thereof or other
anti-viral or anti-fusogenic peptide of interest. Reactive groups will generally be
stable in an aqueous environment and will usually be carboxy, phosphoryl, or convenient
acyl group, either as an ester or a mixed anhydride, or an imidate, thereby capable
of forming a covalent bond with functionalities such as an amino group, a hydroxy
or a thiol at the target site on mobile blood components. For the most part, the esters
will involve phenolic compounds, or be thiol esters, alkyl esters, phosphate esters,
or the like.
[0025] Functionalities: Functionalities are groups on blood components to which reactive groups on modified
anti-viral peptides react to form covalent bonds. Functionalities include hydroxyl
groups for bonding to ester reactive entities; thiol groups for bonding to maleimides,
imidates and thioester groups; amino groups for bonding to carboxy, phosphoryl or
acyl groups and carboxyl groups for bonding to amino groups.
[0026] Blood Components: Blood components may be either fixed or mobile. Fixed blood components are non-mobile
blood components and include tissues, membrane receptors, interstitial proteins, fibrin
proteins, collagens, platelets, endothelial cells, epithelial cells and their associated
membrane and membraneous receptors, somatic body cells, skeletal and smooth muscle
cells, neuronal components, osteocytes and osteoclasts and all body tissues especially
those associated with the circulatory and lymphatic systems. Mobile blood components
are blood components that do not have a fixed situs for any extended period of time,
generally not exceeding 5, more usually one minute. These blood components are not
membrane-associated and are present in the blood for extended periods of time and
are present in a minimum concentration of at least 0.1 µg/ml. Mobile blood components
include serum albumin, transferrin, ferritin and immunoglobulins such as IgM and IgG.
The half-life of mobile blood components is at least about 12 hours.
[0027] Protective Groups: Protective groups are chemical moieties utilized to protect peptide derivatives
from reacting with themselves. Various protective groups are disclosed herein and
in U.S. 5,493,007, which is hereby incorporated by reference. Such protective groups
include acetyl, fluorenylmethyloxycarbonyl (Fmoc), t-butyloxycarbonyl-(Boc), benzyloxycarbonyl
(CBZ), and the like. The specific protected amino acids are depicted in Table 1.
TABLE 1
| NATURAL AMINO ACIDS AND THEIR ABBREVIATIONS |
| Name |
3-Letter
Abbreviation |
1-Letter
Abbreviation |
Modified Amino Acids |
| Alanine |
Ala |
A |
Fmoc-Ala-OH |
| Arginine |
Arg |
R |
Fmoc-Arg(Pbf)-OH |
| Asparagine |
Asn |
N |
Fmoc-Asn(Trt)-OH |
| Aspartic acid |
Asp |
D |
Asp(tBu)-OH |
| Cysteine |
Cys |
C |
Fmoc-Cys(Trt) |
| Glutamic acid |
Glu |
E |
Fmoc-Glu(tBu)-OH |
| Glutamine |
Gln |
Q |
Fmoc-Gln(Trt)-OH |
| Glycine |
Gly |
G |
Fmoc-Gly-OH |
| Histidine |
His |
H |
Fmoc-His(Trt)-OH |
| Isoleucine |
lie |
I |
Fmoc-Ile-OH |
| Leucine |
Leu |
L |
Fmoc-Leu-OH |
| Lysine |
Lys |
Z |
Boc-Lys(Aloc)-OH |
| Lysine |
Lys |
X |
Fmoc-Lys(Aloc)-OH |
| Lysine |
Lys |
K |
Fmoc-Lys(Mtt)-OH |
| Methionine |
Met |
M |
Fmoc-Met-OH |
| Phenylalanine |
Phe |
F |
Fmoc-Phe-OH |
| Proline |
Pro |
P |
Fmoc-Pro-OH |
| Serine |
Ser |
S |
Fmoc-Ser(tBu)-OH |
| Threonine |
Thr |
T |
Fmoc-Thr(tBu)-OH |
| Tryptophan |
Trp |
W |
Fmoc-Trp(Boc)-OH |
| Tyrosine |
Tyr |
Y |
Boc-Tyr(tBu)-OH |
| Valine |
Val |
V |
Fmoc-Val-OH |
[0028] Linking Groups: Linking (spacer) groups are chemical moieties that link or connect reactive entities
to antiviral or antifusogenic peptides. Linking groups may comprise one or more alkyl
moeities, alkoxy moeity, alkenyl moeity, alkynyl moeity or amino moeity substituted
by alkyl moeities, cycloalkyl moeity, polycyclic moeity, aryl moeity, polyaryl moeities,
substituted aryl moeities, heterocyclic moeities, and substituted heterocyclic moeities.
Linking groups may also comprise poly ethoxy amino acids, such as AEA ((2-amino) ethoxy
acetic acid) or a preferred linking group AEEA ([2-(2-amino) ethoxy)] ethoxy acetic
acid.
[0029] Sensitive Functional Groups - A sensitive functional group is a group of atoms that represents a potential reaction
site on an antiviral and/or antifusogenic peptide. If present, a sensitive functional
group may be chosen as the attachment point for the linker-reactive group modification.
Sensitive functional groups include but are not limited to carboxyl, amino, thiol,
and hydroxyl groups.
[0030] Modified Peptides ― A modified peptide is an antiviral and/or antifusogenic peptide that has been modified
by attaching a reactive group. The reactive group may be attached to the peptide either
via a linking group, or optionally without using a linking group. It is also contemplated
that one or more additional amino acids may be added to the peptide to facilitate
the attachment of the reactive entity. Modified peptides may be administered
in vivo such that conjugation with blood components occurs
in vivo, or they may be first conjugated to blood components
in vitro and the resulting conjugated peptide (as defined below) administered
in vivo.
[0031] Conjugated Peptides ― A conjugated peptide is a modified peptide that has been conjugated to a blood
component via a covalent bond formed between the reactive group of the modified peptide
and the functionalities of the blood component, with or without a linking group. As
used throughout this application, the term "conjugated peptide" can be made more specific
to refer to particular conjugated peptides, for example "conjugated DP178" or "conjugated
DP107."
[0032] Taking into account these definitions, the present invention takes advantage of the
properties of existing anti-viral and antifusogenic peptides. The viruses that may
be inhibited by the peptides include, but are not limited to all strains of viruses
listed, e.g., in U.S. Patent Nos. 6,013,263, 6,017,536 and 6,020,459 at Tables V-VII
and IX-XIV therein. These viruses include, e.g., human retroviruses, including HIV-1,
HIV-2, and human T-lympocyte viruses (HTLV-I and HTLV-II), and non-human retroviruses,
including bovine leukosis virus, feline sarcoma virus, feline leukemia virus, simian
immunodeficiency virus (SIV), simian sarcoma virus, simian leukemia, and sheep progress
pneumonia virus. Non-retroviral viruses may also be inhibited by the peptides of the
present invention, including human respiratory syncytial virus (RSV), canine distemper
virus, Newcastle Disease virus, human parainfluenza virus (HPIV), influenza viruses,
measles viruses (MeV), Epstein-Barr viruses, hepatitis B viruses, and simian Mason-Pfizer
viruses. Non-enveloped viruses may also be inhibited by the peptides of the present
invention, and include, but are not limited to, picornaviruses such as polio viruses,
hepatitis A virus, enteroviruses, echoviruses, coxsackie viruses, papovaviruses such
as papilloma virus, parvoviruses, adenoviruses, and reoviruses.
[0033] As an example, the mechanism of action of HIV fusion peptides has been described
as discussed in the background section of this application and antiviral and antifusogenic
properties of the peptides have been well established. A synthetic peptide corresponding
to the carboxyl-terminal ectodomain sequence (for instance, amino acid residues 643-678
of HIV-1 class B, of the LAI strain or residues 638-673 from similar strain as well
as residues 558-595) has been shown to inhibit virus-mediated cell-cell fusion completely
at low concentration. The fusion peptide competes with the leucine zipper region of
the native viral gp41 thus resulting in the interference of the fusion/infection of
the virus into the cell.
[0034] The focus of the present invention is to modify a selected anti-viral and/or antifusogenic
peptide with the DAC (Drug Activity Complex) technology to confer to this peptide
improved bio-availability, extended half-life and better distribution through selective
conjugation of the peptide onto a protein carrier but without modifying the peptide's
anti-viral properties. The carrier of choice (but not limited to) for this invention
would be albumin conjugated through its free thiol by an anti-viral and/or antifusogenic
peptide modified with a maleimide moiety.
[0035] Several peptide sequences have been described in the literature as highly potent
for the prevention of HIV-1 fusion/infection. As examples, peptide DP178 binds to
a conformation of gp41 that is relevant for fusion. Thus in one embodiment of the
invention, DP178 and DP178-like peptides are modified. Likewise, other embodiments
of the invention include modification of DP107 and DP107-like peptide for use against
HIV, as well as peptides analagous to DP107 and DP178 that are found in RSV, HPV,
MeV and SIV viruses.
1. DP178 and DP107
A. DP178 Peptides
[0036] The DP178 peptide corresponds to amino acid residues 638 to 673 of the transmembrane
protein gp41 from the HIV-1
LAI isolate, and has the 36 amino acid sequence (reading from amino to carboxy terminus):

[0037] In addition to the full-length DP178 36-mer, the peptides of this invention include
truncations of the DP178 peptide comprising peptides of between 3 and 36 amino acid
residues (i.e., peptides ranging in size from a tripeptide to a 36-mer polypeptide),
These truncated peptides are shown in Tables 2 and 3.
[0038] In addition amino acid substitutions of the DP178 peptide are also within the scope
of the invention. HIV-1 and HIV-2 enveloped proteins are structurally distinct, but
there exists a striking amino acid conservation within the DP178-corresponding regions
of HIV-1 and HIV-2. The amino acid conservation is of a periodic nature, suggesting
some conservation of structure and/or function. Therefore, one possible class of amino
acid substitutions would include those amino acid changes which are predicted to stabilize
the structure of the DP178 peptides of the invention. Utilizing the DP178 and DP178
analog sequences described herein, the skilled artisan can readily compile DP178 consensus
sequences and ascertain from these, conserved amino acid residues which would represent
preferred amino acid substitutions.
[0039] The amino acid substitutions may be of a conserved or non-conserved nature. Conserved
amino acid substitutions consist of replacing one or more amino acids of the DP178
peptide sequence with amino acids of similar charge, size, and/or hydrophobicity characteristics,
such as, for example, a glutamic acid (E) to aspartic acid (D) amino acid substitution.
Non-conserved substitutions consist of replacing one or more amino acids of the DP178
peptide sequence with amino acids possessing dissimilar charge, size, and/or hydrophobicity
characteristics, such as, for example, a glutamic acid (E) to valine (V) substitution.
[0040] Amino acid insertions of DP178 may consist of single amino acid residues or stretches
of residues. The insertions may be made at the carboxy or amino terminal end of the
DP178 or DP178 truncated peptides, as well as at a position internal to the peptide.
[0041] Such insertions will generally range from 2 to 15 amino acids in length. It is contemplated
that insertions made at either the carboxy or amino terminus of the peptide of interest
may be of a broader size range, with about 2 to about 50 amino acids being preferred.
One or more such insertions may be introduced into DP178 or DP178 truncations, as
long as such insertions result in peptides which may still be recognized by the 107x178x4,
ALLMOTI5 or PLZIP search motifs described above.
[0042] Preferred amino or carboxy terminal insertions are peptides ranging from about 2
to about 50 amino acid residues in length, corresponding to gp41 protein regions either
amino to or carboxy to the actual DP178 gp41 amino acid sequence, respectively. Thus,
a preferred amino terminal or carboxy terminal amino acid insertion would contain
gp41 amino acid sequences found immediately amino to or carboxy to the DP178 region
of the gp41 protein.
[0043] Deletions of DP178 or DP178 truncations are also within the scope of this invention.
Such deletions consist of the removal of one or more amino acids from the DP178 or
DP178-like peptide sequence, with the lower limit length of the resulting peptide
sequence being 4 to 6 amino acids.
[0044] Such deletions may involve a single contiguous or greater than one discrete portion
of the peptide sequences. One or more such deletions may be introduced into DP178
or DP178 truncations, as long as such deletions result in peptides which may still
be recognized by the 107x178x4, ALLMOTI5 or PLZIP search motifs described above.
B. DP107 Peptides
[0045] DP107 is a 38 amino acid peptide which exhibits potent antiviral activity, and corresponds
to residues 558 to 595 of HIV-1
LAI isolate transmembrane (TM) gp41 glycoprotein, as shown here:

[0046] In addition to the full-length DP107 38-mer, the DP107 peptides include truncations
of the DP107 peptide comprising peptides of between 3 and 38 amino acid residues (i.e.,
peptides ranging in size from a tripeptide to a 38-mer polypeptide), These peptides
are shown in Tables 4 and 5, below.
[0047] In addition, amino acid substitutions of the DP178 peptide are also within the scope
of the invention. As for DP178, there also exists a striking amino acid conservation
within the DP107-corresponding regions of HIV-1 and HIV-2, again of a periodic nature,
suggesting conservation of structure and/or function. Therefore, one possible class
of amino acid substitutions includes those amino acid changes predicted to stabilize
the structure of the DP107 peptides of the invention. Utilizing the DP107 and DP107
analog sequences described herein, the skilled artisan can readily compile DP107 consensus
sequences and ascertain from these, conserved amino acid residues which would represent
preferred amino acid substitutions.
[0048] The amino acid substitutions may be of a conserved or non-conserved nature. Conserved
amino acid substitutions consist of replacing one or more amino acids of the DP107
peptide sequence with amino acids of similar charge, size, and/or hydrophobicity characteristics,
such as, for example, a glutamic acid (E) to aspartic acid (D) amino acid substitution.
Non-conserved substitutions consist of replacing one or more amino acids of the DP107
peptide sequence with amino acids possessing dissimilar charge, size, and/or hydrophobicity
characteristics, such as, for example, a glutamic acid (E) to valine (V) substitution.
[0049] Amino acid insertions may consist of single amino acid residues or stretches of residues.
The insertions may be made at the carboxy or amino terminal end of the DP107 or DP107
truncated peptides, as well as at a position internal to the peptide.
[0050] Such insertions will generally range from 2 to 15 amino acids in length. It is contemplated
that insertions made at either the carboxy or amino terminus of the peptide of interest
may be of a broader size range, with about 2 to about 50 amino acids being preferred.
One or more such insertions may be introduced into DP107 or DP107 truncations, as
long as such insertions result in peptides which may still be recognized by the 107x178x4,
ALLMOTI5 or PLZIP search motifs described above.
[0051] Preferred amino or carboxy terminal insertions are peptides ranging from about 2
to about 50 amino acid residues in length, corresponding to gp41 protein regions either
amino to or carboxy to the actual DP107 gp41 amino acid sequence, respectively. Thus,
a preferred amino terminal or carboxy terminal amino acid insertion would contain
gp41 amino acid sequences found immediately amino to or carboxy to the DP107 region
of the gp41 protein.
[0052] Deletions of DP107 or DP107 truncations are also within the scope of this invention.
Such deletions consist of the removal of one or more amino acids from the DP107 or
DP107-like peptide sequence, with the lower limit length of the resulting peptide
sequence being 4 to 6 amino acids.
[0053] Such deletions may involve a single contiguous or greater than one discrete portion
of the peptide sequences. One or more such deletions may be introduced into DP107
or DP107 truncations, as long as such deletions result in peptides which may still
be recognized by the 107x178x4, ALLMOTI5 or PLZIP search motifs.
[0054] DP107 and DP107 truncations are more fully described in U.S. Patent No. 5,656,480,
which is incorporated herein by reference in its entirety
2. DP107 and DP178 Analogs
[0055] Peptides corresponding to analogs of the DP178, DP178 truncations, DP107 and DP107
truncation sequences of the invention, described, above, may be found in other viruses,
including, for example, non-HIV-1 enveloped viruses, non-enveloped viruses and other
non-viral organisms.
[0056] Such DP178 and DP107 analogs may, for example, correspond to peptide sequences present
in transmembrane ("TM") proteins of enveloped viruses and may, correspond to peptide
sequences present in non enveloped and nonviral organisms. Such peptides may exhibit
antifusogenic activity, antiviral activity, most particularly antiviral activity which
is specific to the virus in which their native sequences are found, or may exhibit
an ability to modulate intracellular processes involving coiled-coil peptide structures.
A. DP178 analogs
[0057] DP178 analogs are peptides whose amino acid sequences are comprised of the amino
acid sequences of peptide regions of, for example, other (i.e., other than HIV-1)
viruses that correspond to the gp41 peptide region from which DP178 was derived. Such
viruses may include, but are not limited to, other HIV-1 isolates and HIV-2 isolates.
[0059] The peptides of SEQ ID NO:3, SEQ ID NO:4 and SEQ ID NO:5 are derived from HIV-1
SF2, HIV-1
RF, and HIV-1
MN, respectively. Other DP178 analogs include those derived from HIV-2, including the
peptides of SEQ ID NO:6 and SEQ ID NO:7, which are derived from HIV-2
ROD and HIV-2
NIHZ, respectively. Still other useful analogs include the peptides of SEQ ID NO:8 and
SEQ ID NO:9, which have been demonstrated to exhibit anti-viral activity.
[0060] In the present invention, it is preferred that the DP178 analogs represent peptides
whose amino acid sequences correspond to the DP178 region of the gp41 protein, it
is also contemplated that the peptides disclosed herein may, additionally, include
amino sequences, ranging from about 2 to about 50 amino acid residues in length, corresponding
to gp41 protein regions either amino to or carboxy to the actual DP178 amino acid
sequence.
[0061] Table 6 and Table 7 show some possible truncations of the HIV-2
NIHZ DP178 analog, which may comprise peptides of between 3 and 36 amino acid residues
(i.e., peptides ranging in size from a tripeptide to a 36-mer polypeptide). Peptide
sequences in these tables are listed from amino (left) to carboxy (right) terminus.
B. Additional DP178 Analogs and DP107 Analogs
[0062] DP178 and DP107 analogs are recognized or identified, for example, by utilizing one
or more of the 107x178x4, ALLMOTI5 or PLZIP computer-assisted search strategies described
above. The search strategy identifies additional peptide regions which are predicted
to have structural and/or amino acid sequence features similar to those of DP107 and/or
DP178.
[0063] The search strategies are described fully in the example presented in Section 9 of
US Patent Nos. 6,013,263, 6,017,536 and 6,020,459. While this search strategy is based,
in part, on a primary amino acid motif deduced from DP107 and DP178, it is not based
solely on searching for primary amino acid sequence homologies, as such protein sequence
homologies exist within, but not between major groups of viruses. For example, primary
amino acid sequence homology is high within the TM protein of different strains of
HIV-1 or within the TM protein of different isolates of simian immunodeficiency virus
(SIV).
[0064] The computer search strategy disclosed in US Patent Nos. 6,013,263, 6,017,536 and
6,020,459 successfully identified regions of proteins similar to DP107 or DP178. This
search strategy was designed to be used with a commercially-available sequence database
package, preferably PC/Gene.
[0065] In US Patent Nos. 6,013,263, 6,017,536 and 6,020,459, a series of search motifs,
the 107x178x4, ALLMOTI5 and PLZIP motifs, were designed and engineered to range in
stringency from strict to broad, with 107x178x4 being preferred. The sequences identified
via such search motifs, such as those listed in Tables V-XIV, of US Patent Nos. 6,013,263,
6,017,536 and 6,020,459 and included in this application by incorporation by reference,
potentially exhibit antifusogenic, such as antiviral, activity, may additionally be
useful in the identification of antifusogenic, such as antiviral, compounds.
3. Other Anti-Viral Peptides
A. Anti-RSV Peptides
[0067] The peptide of SEQ ID NO: 11 is derived from the F1 region of RSV and was identified
in U.S. Patent Nos. 6,103,236 and 6,020,459 using the search motifs described as corresponding
to DP107 (i.e., "DP107-like"). The peptide of SEQ ID NO:29 contains amino acid sequences
contained within the peptide of SEQ ID NO:10 and likewise has been shown to exhibit
anti-RSV activity, in particular, inhibiting fusion and syncytia formation between
RSV-infected and uninfected Hep-2 cells at concentrations of less than 50 µg/ml.
B. Anti-HPIV Peptides
[0069] The peptide of SEQ ID NO:31 is derived from the F1 region of HPIV-3 and was identified
in U.S. Patent Nos. 6,103,236 and 6,020,459 using the search motifs described as corresponding
to DP107 (i.e., "DP107-like"). The peptides of SEQ ID NO:52 and SEQ ID NO:58 each
have amino acid sequences contained within the peptide of SEQ ID NO:30 and each has
been shown to exhibit anti-HPIV-3 activity, in particular, inhibiting fusion and syncytia
formation between HPIV-3-infected Hep2 cells and uninfected CV-1W cells at concentrations
of less than 1 µg/ml.
[0070] The peptide of SEQ ID NO:32 is also derived from the F1 region of HPIV-3 and was
identified in U.S. Patent Nos. 6,103,236 and 6,020,459 using the search motifs described
as corresponding to DP178 (i.e., "DP178-like"). The peptides of SEQ ID NO:35 and SEQ
ID NO:38 to SEQ ID NO:42 each have amino acid sequences contained within the peptide
of SEQ ID NO:32 and each also has been shown to exhibit anti-HPIV-3 activity, in particular,
inhibiting fusion and syncytia formation between HPIV-3-infected Hep2 cells and uninfected
CV-1W cells at concentrations of less than 1 µg/ml.
C. Anti-MeV Peptides
[0072] Sequences derived from measles virus were identified in U.S. Patent Nos. 6,103,236
and 6,020,459 using the search motifs described as corresponding to DP178 (i.e., "DP178-like").
The peptides of SEQ ID NO:77, SEQ ID NO:79, SEQ ID NO:81 and SEQ ID NO:83 each have
amino acid sequences so identified, and each has been shown to exhibit anti-MeV activity,
in particular, inhibiting fusion and syncytia formation between MeV-infected Hep2
and uninfected Vero cells at concentrations of less than 1 µg/ml.
D. Anti-SIV Peptides
[0074] Sequences derived from SIV transmembrane fusion protein were identified in U.S. Patent
Nos. 6,103,236 and 6,020,459 using the search motifs described as corresponding to
DP178 (i.e., "DP178-like"). The peptides of SEQ ID NO:64 to SEQ ID NO:73 each have
amino acid sequences so identified, and each has been shown to exhibit potent anti-SIV
activity as crude peptides.
4. Modification of Anti-Viral and Antifusogenic Peptides
[0075] The invention contemplates modifying peptides that exhibit anti-viral and/or antifusogenic
activity, including such modifications of DP-107 and DP-178 and analogs thereof. Such
modified peptides can react with the available reactive functionalities on blood components
via covalent linkages. The invention also relates to such modifications, such combinations
with blood components, and methods for their use. These methods include extending
the effective therapeutic life of the conjugated anti-viral peptides derivatives as
compared to administration of the unconjugated peptides to a patient. The modified
peptides are of a type designated as a DAC (Drug Affinity Complex) which comprises
the anti-viral peptide molecule and a linking group together with a chemically reactive
group capable of reaction with a reactive functionality of a mobile blood protein.
By reaction with the blood component or protein the modified peptide, or DAC, may
be delivered via the blood to appropriate sites or receptors.
[0076] To form covalent bonds with functionalities on the protein, one may use as a reactive
group a wide variety of active carboxyl groups, particularly esters, where the hydroxyl
moiety is physiologically acceptable at the levels required to modify the peptide.
While a number of different hydroxyl groups may be employed in these reactive groups,
the most convenient would be N-hydroxysuccinimide or (NHS), N-hydroxy-sulfosuccinimide
(sulfo-NHS). In preferred embodiments of this invention, the functionality on the
protein will be a thiol group and the reactive group will be a maleimido-containing
group such as gamma-maleimide-butyralamide (GMBA) or maleimidopropionic acid (MPA)
[0077] Primary amines are the principal targets for NHS esters. Accessible α-amine groups
present on the N-termini of proteins react with NHS esters. However, α-amino groups
on a protein may not be desirable or available for the NHS coupling. While five amino
acids have nitrogen in their side chains, only the ε-amine of lysine reacts significantly
with NHS esters. An amide bond is formed when the NHS ester conjugation reaction reacts
with primary amines releasing N-hydroxysuccinimide as demonstrated in the schematic
below.

[0078] In the preferred embodiments of this invention, the functional group on this protein
will be a thiol group and the chemically reactive group will be a maleimido-containing
group such as MPA or GMBA (gamma-maleimide-butyralamide). The maleimido group is most
selective for sulfhydryl groups on peptides when the pH of the reaction mixture is
kept between 6.5 and 7.4. At pH 7.0, the rate of reaction of maleimido groups with
sulfhydryls is 1000-fold faster than with amines. A stable thioether linkage between
the maleimido group and the sulfhydryl is formed which cannot be cleaved under physiological
conditions, as demonstrated in the following schematic.

A. Specific Labeling.
[0079] Preferably, the modified peptides of this invention are designed to specifically
react with thiol groups on mobile blood proteins. Such reaction is preferably established
by covalent bonding of the peptide modified with a maleimide link (e.g. prepared from
GMBS, MPA or other maleimides) to a thiol group on a mobile blood protein such as
serum albumin or IgG.
[0080] Under certain circumstances, specific labeling with maleimides offers several advantages
over non-specific labeling of mobile proteins with groups such as NHS and sulfo-NHS.
Thiol groups are less abundant
in vivo than amino groups. Therefore, the maleimide-modified peptides of this invention,
i.e., maleimide peptides, will covalently bond to fewer proteins. For example, in
albumin (the most abundant blood protein) there is only a single thiol group. Thus,
peptide-maleimide-albumin conjugates will tend to comprise approximately a 1:1 molar
ratio of peptide to albumin. In addition to albumin, IgG molecules (class II) also
have free thiols. Since IgG molecules and serum albumin make up the majority of the
soluble protein in blood they also make up the majority of the free thiol groups in
blood that are available to covalently bond to maleimide-modified peptides.
[0081] Further, even among free thiol-containing blood proteins, including IgGs, specific
labeling with maleimides leads to the preferential formation of peptide-maleimide-albumin
conjugates, due to the unique characteristics of albumin itself. The single free thiol
group of albumin, highly conserved among species, is located at amino acid residue
34 (Cys
34). It has been demonstrated recently that the Cys
34 of albumin has increased reactivity relative to free thiols on other free thiol-containing
proteins. This is due in part to the very low pK value of 5.5 for the Cys
34 of albumin. This is much lower than typical pK values for cysteine residues in general,
which are typically about 8. Due to this low pK, under normal physiological conditions
Cys
34 of albumin is predominantly in the ionized form, which dramatically increases its
reactivity. In addition to the low pK value of Cys
34, another factor which enhances the reactivity of Cys
34 is its location, which is in a crevice close to the surface of one loop of region
V of albumin. This location makes Cys
34 very available to ligands of all kinds, and is an important factor in Cys
34's biological role as free radical trap and free thiol scavenger. These properties
make Cys
34 highly reactive with maleimide-peptides, and the reaction rate acceleration can be
as much as 1000-fold relative to rates of reaction of maleimide-peptides with other
free-thiol containing proteins.
[0082] Another advantage of peptide-maleimide-albumin conjugates is the reproducibility
associated with the 1:1 loading of peptide to albumin specifically at Cys
34. Other techniques, such as glutaraldehyde, DCC, EDC and other chemical activations
of, e.g, free amines, lack this selectivity. For example, albumin contains 52 lysine
residues, 25-30 of which are located on the surface of albumin and therefore accessible
for conjugation. Activating these lysine residues, or alternatively modifying peptides
to couple through these lysine residues, results in a heterogenous population of conjugates.
Even if 1:1 molar ratios of peptide to albumin are employed, the yield will consist
of multiple conjugation products, some containing 0, 1, 2 or more peptides per albumin,
and each having peptides randomly coupled at any one or more of the 25-30 available
lysine sites. Given the numerous possible combinations, characterization of the exact
composition and nature of each conjugate batch becomes difficult, and batch-to-batch
reproducibility is all but impossible, making such conjugates less desirable as a
therapeutic. Additionally, while it would seem that conjugation through lysine residues
of albumin would at least have the advantage of delivering more therapeutic agent
per albumin molecule, studies have shown that a 1:1 ratio of therapeutic agent to
albumin is preferred. In an article by Stehle, et al., "The Loading Rate Determines
Tumor Targeting properties of Methotrexate-Albumin Conjugates in Rats,"
Anti-Cancer Drugs, Vol. 8, pp. 677-685 (1988), incorporated herein in its entirety, the authors report
that a 1:1 ratio of the anti-cancer methotrexate to albumin conjugated via glutaraldehyde
gave the most promising results. These conjugates were preferentially taken up by
tumor cells, whereas conjugates bearing 5:1 to 20:1 methotrexate molecules had altered
HPLC profiles and were quickly taken up by the liver
in vivo. It is postulated that at these higher ratios, conformational changes to albumin
diminish its effectiveness as a therapeutic carrier.
[0083] Through controlled administration of maleimide-peptides
in vivo, one can control the specific labeling of albumin and IgG
in vivo. In typical administrations, 80-90% of the administered maleimide-peptides will label
albumin and less than 5% will label IgG. Trace labeling of free thiols such as glutathione
will also occur. Such specific labeling is preferred for
in vivo use as it permits an accurate calculation of the estimated half-life of the administered
agent.
[0084] In addition to providing controlled specific
in vivo labeling, maleimide-peptides can provide specific labeling of serum albumin and IgG
ex vivo. Such
ex vivo labeling involves the addition of maleimide-peptides to blood, serum or saline solution
containing serum albumin and/or IgG. Once conjugation has occurred
ex vivo with the maleimide-peptides, the blood, serum or saline solution can be readministered
to the patient's blood for
in vivo treatment.
[0085] In contrast to NHS-peptides, maleimide-peptides are generally quite stable in the
presence of aqueous solutions and in the presence of free amines. Since maleimide-peptides
will only react with free thiols, protective groups are generally not necessary to
prevent the maleimide-peptides from reacting with itself. In addition, the increased
stability of the modified peptide permits the use of further purification steps such
as HPLC to prepare highly purified products suitable for
in vivo use. Lastly, the increased chemical stability provides a product with a longer shelf
life.
B. Non-Specific Labeling.
[0086] The anti-viral peptides of the invention may also be modified for non-specific labeling
of blood components. Bonds to amino groups will also be employed, particularly with
the formation of amide bonds for non-specific labeling. To form such bonds, one may
use as a chemically reactive group a wide variety of active carboxyl groups, particularly
esters, where the hydroxyl moiety is physiologically acceptable at the levels required.
While a number of different hydroxyl groups may be employed in these linking agents,
the most convenient would be N-hydroxysuccinimide (NHS) and N-hydroxy-sulfosuccinimide
(sulfo-NHS).
[0087] Other linking agents which may be utilized are described in U.S. Patent 5,612,034,
which is hereby incorporated herein.
[0088] The various sites with which the chemically reactive group of the modified peptides
may react
in vivo include cells, particularly red blood cells (erythrocytes) and platelets, and proteins,
such as immunoglobulins, including IgG and IgM, serum albumin, ferritin, steroid binding
proteins, transferrin, thyroxin binding protein, α- 2-macroglobulin, and the like.
Those receptors with which the modified peptides react, which are not long-lived,
will generally be eliminated from the human host within about three days. The proteins
indicated above (including the proteins of the cells) will remain at least three days,
and may remain five days or more (usually not exceeding 60 days, more usually not
exceeding 30 days) particularly as to the half life, based on the concentration in
the blood.
[0089] For the most part, reaction will be with mobile components in the blood, particularly
blood proteins and cells, more particularly blood proteins and erythrocytes. By "mobile"
is intended that the component does not have a fixed situs for any extended period
of time, generally not exceeding 5 minutes, more usually one minute, although some
of the blood component may be relatively stationary for extended periods of time.
Initially, there will be a relatively heterogeneous population of functionalized proteins
and cells. However, for the most part, the population within a few days will vary
substantially from the initial population, depending upon the half-life of the functionalized
proteins in the blood stream. Therefore, usually within about three days or more,
IgG will become the predominant functionalized protein in the blood stream.
[0090] Usually, by day 5 post-administration, IgG, serum albumin and erythrocytes will be
at least about 60 mole %, usually at least about 75 mole %, of the conjugated components
in blood, with IgG, IgM (to a substantially lesser extent) and serum albumin being
at least about 50 mole %, usually at least about 75 mole %, more usually at least
about 80 mole %, of the non-cellular conjugated components.
[0091] The desired conjugates of non-specific modified peptides to blood components may
be prepared
in vivo by administration of the modified peptides to the patient, which may be a human or
other mammal. The administration may be done in the form of a bolus or introduced
slowly over time by infusion using metered flow or the like.
[0092] If desired, the subject conjugates may also be prepared
ex vivo by combining blood with modified peptides of the present invention, allowing covalent
bonding of the modified peptides to reactive functionalities on blood components and
then returning or administering the conjugated blood to the host. Moreover, the above
may also be accomplished by first purifying an individual blood component or limited
number of components, such as red blood cells, immunoglobulins, serum albumin, or
the like, and combining the component or components
ex vivo with the chemically reactive modified peptides. The functionalized blood or blood
component may then be returned to the host to provide
in vivo the subject therapeutically effective conjugates. The blood also may be treated to
prevent coagulation during handling
ex vivo.
5. Synthesis of Modified Anti-Viral and Anti-Fusogenic Peptides
A. Peptide Synthesis
[0093] Anti-viral and/or anti-fusogenic peptides according to the present invention may
be synthesized by standard methods of solid phase peptide chemistry known to those
of ordinary skill in the art. For example, peptides may be synthesized by solid phase
chemistry techniques following the procedures described by Steward and Young (Steward,
J. M. and Young, J. D., Solid Phase Peptide Synthesis, 2nd Ed., Pierce Chemical Company,
Rockford, I11., (1984) using an Applied Biosystem synthesizer. Similarly, multiple
peptide fragments may be synthesized then linked together to form larger peptides.
These synthetic peptides can also be made with amino acid substitutions at specific
locations.
[0094] For solid phase peptide synthesis, a summary of the many techniques may be found
in J. M. Stewart and J. D. Young, Solid Phase Peptide Synthesis, W. H. Freeman Co.
(San Francisco), 1963 and J. Meienhofer, Hormonal Proteins and Peptides, vol. 2, p.
46, Academic Press (New York), 1973. For classical solution synthesis see G. Schroder
and K. Lupke, The Peptides, Vol. 1, Acacemic Press (New York). In general, these methods
comprise the sequential addition of one or more amino acids or suitably protected
amino acids to a growing peptide chain. Normally, either the amino or carboxyl group
of the first amino acid is protected by a suitable protecting group. The protected
or derivatized amino acid is then either attached to an inert solid support or utilized
in solution by adding the next amino acid in the sequence having the complimentary
(amino or carboxyl) group suitably protected and under conditions suitable for forming
the amide linkage. The protecting group is then removed from this newly added amino
acid residue and the next amino acid (suitably protected) is added, and so forth.
[0095] After all the desired amino acids have been linked in the proper sequence, any remaining
protecting groups (and any solid support) are removed sequentially or concurrently
to afford the final polypeptide. By simple modification of this general procedure,
it is possible to add more than one amino acid at a time to a growing chain, for example,
by coupling (under conditions which do not racemize chiral centers) a protected tripeptide
with a properly protected dipeptide to form, after deprotection, a pentapeptide.
[0096] A particularly preferred method of preparing compounds of the present invention involves
solid phase peptide synthesis wherein the amino acid α-N-terminal is protected by
an acid or base sensitive group. Such protecting groups should have the properties
of being stable to the conditions of peptide linkage formation while being readily
removable without destruction of the growing peptide chain or racemization of any
of the chiral centers contained therein. Suitable protecting groups are 9-fluorenylmethyloxycarbonyl
(Fmoc), t-butyloxycarbonyl (Boc), benzyloxycarbonyl (Cbz), biphenylisopropyloxycarbonyl
, t-amyloxycarbonyl, isobornyloxycarbonyl, α, α-dimethyl-3,5-dimethoxybenzyloxycarbonyl,
o-nitrophenylsulfenyl, 2-cyano-t-butyloxycarbonyl, and the like. The 9-fluorenyl-methyloxycarbonyl
(Fmoc) protecting group is particularly preferred for the synthesis of the peptides
of the present invention. Other preferred side chain protecting groups are, for side
chain amino groups like lysine and arginine, 2,2,5,7,8-pentamethylchroman-6-sulfonyl
(pmc), nitro, p-toluenesulfonyl, 4-methoxybenzene-sulfonyl, Cbz, Boc, and adamantyloxycarbonyl;
for tyrosine, benzyl, o-bromobenzyloxycarbonyl, 2,6-dichlorobenzyl, isopropyl, t-butyl
(t-Bu), cyclohexyl, cyclopenyl and acetyl (Ac); for serine, t-butyl, benzyl and tetrahydropyranyl;
for histidine, trityl, benzyl, Cbz, p-toluenesulfonyl and 2,4-dinitrophenyl; for tryptophan,
formyl; for asparticacid and glutamic acid, benzyl and t-butyl and for cysteine, triphenylmethyl
(trityl).
[0097] In the solid phase peptide synthesis method, the α-C-terminal amino acid is attached
to a suitable solid support or resin. Suitable solid supports useful for the above
synthesis are those materials which are inert to the reagents and reaction conditions
of the stepwise condensation-deprotection reactions, as well as being insoluble in
the media used. The preferred solid support for synthesis of α-C-terminal carboxy
peptides is 4-hydroxymethylphenoxymethyl-copoly(styrene-1% divinylbenzene). The preferred
solid support for α-C-terminal amide peptides is the 4-(2',4'-dimethoxyphenyl-Fmoc-aminomethyl)phenoxyacetamidoethyl
resin available from Applied Biosystems (Foster City, Calif.). The α-C-terminal amino
acid is coupled to the resin by means of N,N'-dicyclohexylcarbodiimide (DCC), N,N'-diisopropylcarbodiimide
(DIC) or O-benzotriazol-1-yl-N,N,N',N'-tetramethyluronium-hexafluorophosphate (HBTU),
with or without 4-dimethylaminopyridine (DMAP), 1-hydroxybenzotriazole (HOBT), benzotriazol-1-yloxy-tris(dimethylamino)phosphonium-hexafluorophosphate
(BOP) or bis(2-oxo-3-oxazolidinyl)phosphine chloride (BOPCl), mediated coupling for
from about 1 to about 24 hours at a temperature of between 10° and 50°C in a solvent
such as dichloromethane or DMF.
[0098] When the solid support is 4-(2',4'-dimethoxyphenyl-Fmoc-aminomethyl)phenoxy-acetamidoethyl
resin, the Fmoc group is cleaved with a secondary amine, preferably piperidine, prior
to coupling with the α-C-terminal amino acid as described above. The preferred method
for coupling to the deprotected 4-(2',4'-dimethoxyphenyl-Fmoc-aminomethyl)phenoxy-acetamidoethyl
resin is O-benzotriazol-1-yl-N,N,N',N'-tetramethyluroniumhexafluoro-phosphate (HBTU,
1 equiv.) and 1-hydroxybenzotriazole (HOBT, 1 equiv.) in DMF. The coupling of successive
protected amino acids can be carried out in an automatic polypeptide synthesizer as
is well known in the art. In a preferred embodiment, the α-N-terminal amino acids
of the growing peptide chain are protected with Fmoc. The removal of the Fmoc protecting
group from the α-N-terminal side of the growing peptide is accomplished by treatment
with a secondary amine, preferably piperidine. Each protected amino acid is then introduced
in about 3-fold molar excess, and the coupling is preferably carried out in DMF. The
coupling agent is normally O-benzotriazol-1-yl-N,N,N',N'-tetramethyluroniumhexafluorophosphate
(HBTU, 1 equiv.) and 1-hydroxybenzotriazole (HOBT, 1 equiv.).
[0099] At the end of the solid phase synthesis, the polypeptide is removed from the resin
and deprotected, either in successively or in a single operation. Removal of the polypeptide
and deprotection can be accomplished in a single operation by treating the resin-bound
polypeptide with a cleavage reagent comprising thioanisole, water, ethanedithiol and
trifluoroacetic acid. In cases wherein the α-C-terminal of the polypeptide is an alkylamide,
the resin is cleaved by aminolysis with an alkylamine. Alternatively, the peptide
may be removed by transesterification, e.g. with methanol, followed by aminolysis
or by direct transamidation. The protected peptide may be purified at this point or
taken to the next step directly. The removal of the side chain protecting groups is
accomplished using the cleavage cocktail described above. The fully deprotected peptide
is purified by a sequence of chromatographic steps employing any or all of the following
types: ion exchange on a weakly basic resin (acetate form); hydrophobic adsorption
chromatography on underivitized polystyrene-divinylbenzene (for example, Amberlite
XAD); silica gel adsorption chromatography; ion exchange chromatography on carboxymethylcellulose;
partition chromatography, e.g. on Sephadex G-25, LH-20 or countercurrent distribution;
high performance liquid chromatography (HPLC), especially reverse-phase HPLC on octyl-
or octadecylsilyl-silica bonded phase column packing.
[0100] Molecular weights of these ITPs are determined using Fast Atom Bombardment (FAB)
Mass Spectroscopy.
(1) N-Terminal Protective Groups
[0101] As discussed above, the term "N-protecting group" refers to those groups intended
to protect the α-N-terminal of an amino acid or peptide or to otherwise protect the
amino group of an amino acid or peptide against undesirable reactions during synthetic
procedures. Commonly used N-protecting groups are disclosed in Greene, "Protective
Groups In Organic Synthesis," (John Wiley & Sons, New York (1981)), which is hereby
incorporated by reference. Additionally, protecting groups can be used as pro-drugs
which are readily cleaved
in vivo, for example, by enzymatic hydrolysis, to release the biologically active parent.
α-N-protecting groups comprise loweralkanoyl groups such as formyl, acetyl ("Ac"),
propionyl, pivaloyl, t-butylacetyl and the like; other acyl groups include 2-chloroacetyl,
2-bromoacetyl, trifluoroacetyl, trichloroacetyl, phthalyl, o-nitrophenoxyacetyl, chlorobutyryl,
benzoyl, 4-chlorobenzoyl, 4-bromobenzoyl, 4-nitrobenzoyl and the like; sulfonyl groups
such as benzenesulfonyl, p-toluenesulfonyl and the like; carbamate forming groups
such as benzyloxycarbonyl, p-chlorobenzyloxycarbonyl, p-methoxybenzyloxycarbonyl,
p-nitrobenzyloxycarbonyl, 2-nitrobenzyloxycarbonyl, p-bromobenzyloxycarbonyl, 3,4-dimethoxybenzyloxycarbonyl,
3,5-dimethoxybenzyloxycarbonyl, 2,4-dirnethoxybenzyloxycarbonyl, 4-ethoxybenzyloxycarbonyl,
2-nitro-4,5-dimethoxybenzyloxycarbonyl, 3,4,5-trimethoxybenzyloxycarbonyl, 1-(p-biphenylyl)-1-methylethoxycarbonyl,
α,α-dimethyl-3,5-dimethoxybenzyloxycarbonyl, benzhydryloxycarbonyl, t-butyloxycarbonyl
(Boc), diisopropylmethoxycarbonyl, isopropyloxycarbonyl, ethoxycarbonyl, methoxycarbonyl,
allyloxycarbonyl, 2,2,2,-trichloroethoxycarbonyl, phenoxycarbonyl, 4-nitrophenoxycarbonyl,
fluorenyl-9-methoxycarbonyl, cyclopentyloxycarbonyl, adamantyloxycarbonyl, cyclohexyloxycarbonyl,
phenylthiocarbonyl and the like; arylalkyl groups such as benzyl, triphenylmethyl,
benzyloxymethyl, 9-fluorenylmethyloxycarbonyl (Fmoc) and the like and silyl groups
such as trimethylsilyl and the like.
(2) Carboxy Protective Groups
[0102] As discussed above, the term "carboxy protecting group" refers to a carboxylic acid
protecting ester or amide group employed to block or protect the carboxylic acid functionality
while the reactions involving other functional sites of the compound are performed.
Carboxy protecting groups are disclosed in Greene, "Protective Groups in Organic Synthesis"
pp. 152-186 (1981), which is hereby incorporated by reference. Additionally, a carboxy
protecting group can be used as a pro-drug whereby the carboxy protecting group can
be readily cleaved
in vivo, for example by enzymatic hydrolysis, to release the biologically active parent. Such
carboxy protecting groups are well known to those skilled in the art, having been
extensively used in the protection of carboxyl groups in the penicillin and cephalosporin
fields as described in U.S. Pat. Nos. 3,840,556 and 3,719,667, the disclosures of
which are hereby incorporated herein by reference. Representative carboxy protecting
groups are C
1-C
8 loweralkyl (e.g., methyl, ethyl or t-butyl and the like); arylalkyl such as phenethyl
or benzyl and substituted derivatives thereof such as alkoxybenzyl or nitrobenzyl
groups and the like; arylalkenyl such as phenylethenyl and the like; aryl and substituted
derivatives thereofsuch as 5-indanyl and the like; dialkylaminoalkyl such as dimethylaminoethyl
and the like); alkanoyloxyalkyl groups such as acetoxymethyl, butyryloxymethyl, valeryloxymethyl,
isobutyryloxymethyl, isovaleryloxymethyl, 1-(propionyloxy)-1-ethyl, 1-(pivaloyloxyl)-1-ethyl,
1-methyl-1-(propionyloxy)-1-ethyl, pivaloyloxymethyl, propionyloxymethyl and the like;
cycloalkanoyloxyalkyl groups such as cyclopropylcarbonyloxymethyl, cyclobutylcarbonyloxymethyl,
cyclopentylcarbonyloxymethyl, cyclohexylcarbonyloxymethyl and the like; aroyloxyalkyl
such as benzoyloxymethyl, benzoyloxyethyl and the like; arylalkylcarbonyloxyalkyl
such as benzylcarbonyloxymethyl, 2-benzylcarbonyloxyethyl and the like; alkoxycarbonylalkyl
or cycloalkyloxycarbonylalkyl such as methoxycarbonylmethyl, cyclohexyloxycarbonylmethyl,
1-methoxycarbonyl-1-ethyl and the like; alkoxycarbonyloxyalkyl or cycloalkyloxycarbonyloxyalkyl
such as methoxycarbonyloxymethyl, t-butyloxycarbonyloxymethyl, 1-ethoxycarbonyloxy-1-ethyl,
1-cyclohexyloxycarbonyloxy-1-ethyl and the like; aryloxycarbonyloxyalkyl such as 2-(phenoxycarbonyloxy)ethyl,
2-(5-indanyloxycarbonyloxy)ethyl and the like; alkoxyalkylcarbonyloxyalkyl such as
2-(1-methoxy-2-methylpropan-2-oyloxy)ethyl and like; arylalkyloxycarbonyloxyalkyl
such as 2-(benzyloxycarbonyloxy)ethyl and the like; arylalkenyloxycarbonyloxyalkyl
such as 2-(3-phenylpropen-2-yloxycarbonyloxy)ethyl and the like; alkoxycarbonylaminoalkyl
such as t-butyloxycarbonylaminomethyl and the like; alkylaminocarbonylaminoalkyl such
as methylaminocarbonylaminomethyl and the like; alkanoylaminoalkyl such as acetylaminomethyl
and the like; heterocycliccarbonyloxyalkyl such as 4-methylpiperazinylcarbonyloxymethyl
and the like; dialkylaminocarbonylalkyl such as dimethylaminocarbonylmethyl, diethylaminocarbonylmethyl
and the like; (5-(loweralkyl)-2-oxo-1,3-dioxolen-4-yl)alkyl such as (5-t-butyl-2-oxo-1,3-dioxolen-4-yl)methyl
and the like; and (5-phenyl-2-oxo-1,3-dioxolen-4-yl)alkyl such as (5-phenyl-2-oxo-1,3-dioxolen-4-yl)methyl
and the like.
[0103] Representative amide carboxy protecting groups are aminocarbonyl and loweralkylaminocarbonyl
groups.
[0104] Preferred carboxy-protected compounds of the invention are compounds wherein the
protected carboxy group is a loweralkyl, cycloalkyl or arylalkyl ester, for example,
methyl ester, ethyl ester, propyl ester, isopropyl ester, butyl ester, sec-butyl ester,
isobutyl ester, amyl ester, isoamyl ester, octyl ester, cyclohexyl ester, phenylethyl
ester and the like or an alkanoyloxyalkyl, cycloalkanoyloxyalkyl, aroyloxyalkyl or
an arylalkylcarbonyloxyalkyl ester. Preferred amide carboxy protecting groups are
loweralkylaminocarbonyl groups. For example, aspartic acid may be protected at the
α-C-terminal by an acid labile group (e.g. t-butyl) and protected at the β-C-terminal
by a hydrogenation labile group (e.g. benzyl) then deprotected selectively during
synthesis.
B. Peptide Modification
[0105] The manner of producing the modified peptides of the present invention will vary
widely, depending upon the nature of the various elements comprising the peptide.
The synthetic procedures will be selected so as to be simple, provide for high yields,
and allow for a highly purified stable product. Normally, the chemically reactive
group will be created at the last stage of the synthesis, for example, with a carboxyl
group, esterification to form an active ester. Specific methods for the production
of modified peptides of the present invention are described below.
[0106] Specifically, the selected peptide is first assayed for anti-viral activity, and
then is modified with the linking group only at either the N-terminus, C-terminus
or interior of the peptide. The anti-viral activity of this modified peptide-linking
group is then assayed. If the anti-viral activity is not reduced dramatically (i.e.,
reduced less than 10-fold), then the stability of the modified peptide-linking group
is measured by its
in vivo lifetime. If the stability is not improved to a desired level, then the peptide is
modified at an alternative site, and the procedure is repeated until a desired level
of anti-viral and stability is achieved.
[0107] More specifically, each peptide selected to undergo modification with a linker and
a reactive entity group will be modified according to the following criteria: if a
terminal carboxylic group is available on the peptide and is not critical for the
retention of anti-viral activity, and no other sensitive functional group is present
on the peptide, then the carboxylic acid will be chosen as attachment point for the
linker-reactive group modification. If the terminal carboxylic group is involved in
anti-viral activity, or if no carboxylic acids are available, then any other sensitive
functional group not critical for the retention of anti-viral activity will be selected
as the attachment point for the linker-reactive entity modification. If several sensitive
functional groups are available on a a peptide, a combination of protecting groups
will be used in such a way that after addition of the linker/reactive entity and deprotection
of all the protected sensitive functional groups, retention of anti-viral activity
is still obtained. If no sensitive functional groups are available on the peptide,
or if a simpler modification route is desired, synthetic efforts will allow for a
modification of the original peptide in such a way that retention of anti-viral is
maintained. In this case the modification will occur at the opposite end of the peptide
[0108] An NHS derivative may be synthesized from a carboxylic acid in absence of other sensitive
functional groups in the peptide. Specifically, such a peptide is reacted with N-hydroxysuccinimide
in anhydrous CH
2Cl
2 and EDC, and the product is purified by chromatography or recrystallized from the
appropriate solvent system to give the NHS derivative.
[0109] Alternatively, an NHS derivative may be synthesized from a peptide that contains
an amino and/or thiol group and a carboxylic acid. When a free amino or thiol group
is present in the molecule, it is preferable to protect these sensitive functional
groups prior to perform the addition of the NHS derivative. For instance, if the molecule
contains a free amino group, a transformation of the amine into a Fmoc or preferably
into a tBoc protected amine is necessary prior to perform the chemistry described
above. The amine functionality will not be deprotected after preparation of the NHS
derivative. Therefore this method applies only to a compound whose amine group is
not required to be freed to induce the desired anti-viral effect. If the amino group
needs to be freed to retain the original properties of the molecule, then another
type of chemistry described below has to be performed.
[0110] In addition, an NHS derivative may be synthesized from a peptide containing an amino
or a thiol group and no carboxylic acid. When the selected molecule contains no carboxylic
acid, an array of bifunctional linkers can be used to convert the molecule into a
reactive NHS derivative. For instance, ethylene glycol-bis(succinimydylsuccinate)
(EGS) and triethylamine dissolved in DMF and added to the free amino containing molecule
(with a ratio of 10:1 in favor of EGS) will produce the mono NHS derivative. To produce
an NHS derivative from a thiol derivatized molecule, one can use N-[-maleimidobutyryloxy]succinimide
ester (GMBS) and triethylamine in DMF. The maleimido group will react with the free
thiol and the NHS derivative will be purified from the reaction mixture by chromatography
on silica or by HPLC.
[0111] An NHS derivative may also be synthesized from a peptide containing multiple sensitive
functional groups. Each case will have to be analyzed and solved in a different manner.
However, thanks to the large array of protecting groups and bifunctional linkers that
are commercially available, this invention is applicable to any peptide with preferably
one chemical step only to modify the peptide (as described above) or two steps (as
described above involving prior protection of a sensitive group) or three steps (protection,
activation and deprotection). Under exceptional circumstances only, would multiple
steps (beyond three steps) synthesis be required to transform a peptide into an active
NHS or maleimide derivative.
[0112] A maleimide derivative may also be synthesized from a peptide containing a free amino
group and a free carboxylic acid. To produce a maleimide derivative from a amino derivatized
molecule, one can use N-[γ-maleimidobutyryloxy]succinimide ester (GMBS) and triethylamine
in DMF. The succinimide ester group will react with the free amino and the maleimide
derivative will be purified from the reaction mixture by crystallization or by chromatography
on silica or by HPLC.
[0113] Finally, a maleimide derivative may be synthesized from a peptide containing multiple
other sensitive functional groups and no free carboxylic acids. When the selected
molecule contains no carboxylic acid, an array of bifunctional crosslinking reagents
can be used to convert the molecule into a reactive NHS derivative. For instance maleimidopropionic
acid (MPA) can be coupled to the free amine to produce a maleimide derivative through
reaction of the free amine with the carboxylic group of MPA using HBTU/HOBt/DIEA activation
in DMF.
[0114] Many other commercially available heterobifunctional crosslinking reagents can alternatively
be used when needed. A large number of bifunctional compounds are available for linking
to entities. Illustrative reagents include: azidobenzoyl hydrazide, N-[4-(p-azidosalicylamino)butyl]-3'-[2'-pyridyldithio)propionamide),
bis-sulfosuccinimidyl suberate, dimethyl adipimidate, disuccinimidyl tartrate, N-y-maleimidobutyryloxysuccinimide
ester, N-hydroxy sulfosuccinimidyl-4-azidobenzoate, N-succinimidyl [4-azidophenyl]-1,3'-dithiopropionate,
N-succinimidyl [4-iodoacetyl]aminobenzoate, glutaraldehyde, and succinimidyl 4-[N-maleimidomethyl]cyclohexane-1-carboxylate.
6. Uses of Modified Anti-Viral Peptides
[0115] Modified anti-viral peptides of the invention may be used as a therapeutic agent
in the treatment of patients who are suffering from viral infection, and can be administered
to patients according to the methods described below and other methods known in the
art. Effective therapeutic dosages of the modified peptides may be determined through
procedures well known by those in the art and will take into consideration any concerns
over potential toxicity of the peptide.
[0116] The modified peptides can also be administered prophylactically to previously uninfected
individuals. This can be advantageous in cases where an individual has been subjected
to a high risk of exposure to a virus, as can occur when individual has been in contact
with an infected individual where there is a high risk of viral transmission. This
can be expecially advantageous where there is known cure for the virus, such as the
HIV virus. As a example, prophylactic administration of a modified anti-HIV peptide
would be advantageous in a situation where a health care worker has been exposed to
blood from an HIV-infected individual, or in other situations where an individual
engaged in high-risk activities that potentially expose that individual to the HIV
virus.
7. Administration of Modified Anti-Viral and Anti-Fusogenic Peptides
[0117] Generally, the modified peptides will be administered in a physiologically acceptable
medium, e.g. deionized water, phosphate buffered saline (PBS), saline, aqueous ethanol
or other alcohol, plasma, proteinaceous solutions, mannitol, aqueous glucose, alcohol,
vegetable oil, or the like. Other additives which may be included include buffers,
where the media are generally buffered at a pH in the range of about 5 to 10, where
the buffer will generally range in concentration from about 50 to 250 mM, salt, where
the concentration of salt will generally range from about 5 to 500 mM, physiologically
acceptable stabilizers, and the like. The compositions may be lyophilized for convenient
storage and transport.
[0118] The subject modified peptides will for the most part be administered parenterally,
such as intravenously (IV), intraarterially (IA), intramuscularly (IM), subcutaneously
(SC), or the like. Administration may in appropriate situations be by transfusion.
In some instances, where reaction of the functional group is relatively slow, administration
may be oral, nasal, rectal, transdermal or aerosol, where the nature of the conjugate
allows for transfer-to the vascular system. Usually a single injection will be employed
although more than one injection may be used, if desired. The modified peptides may
be administered by any convenient means, including syringe, trocar, catheter, or the
like.
[0119] The particular manner of administration will vary depending upon the amount to be
administered, whether a single bolus or continuous administration, or the like. Preferably,
the administration will be intravascularly, where the site of introduction is not
critical to this invention, preferably at a site where there is rapid blood flow,
e.g., intravenously, peripheral or central vein. Other routes may find use where the
administration is coupled with slow release techniques or a protective matrix. The
intent is that the modified peptide be effectively distributed in the blood, so as
to be able to react with the blood components. The concentration of the conjugate
will vary widely, generally ranging from about 1 pg/ml to 50 mg/ml. The total administered
intravascularly will generally be in the range of about 0.1 mg/ml to about 10 mg/ml,
more usually about 1 mg/ml to about 5 mg/ml.
[0120] By bonding to long-lived components of the blood, such as immunoglobulin, serum albumin,
red blood cells and platelets, a number of advantages ensue. The activity of the peptide
is extended for days to weeks. Only one administration need be given during this period
of time. Greater specificity can be achieved, since the active compound will be primarily
bound to large molecules, where it is less likely to be taken up intracellularly to
interfere with other physiological processes.
8. Monitoring the Presence of Modified Peptides
[0121] The blood of the mammalian host may be monitored for the presence of the modified
peptide compound one or more times. By taking a portion or sample of the blood of
the host, one may determine whether the peptide has become bound to the long-lived
blood components in sufficient amount to be therapeutically active and, thereafter,
the level of the peptide compound in the blood. If desired, one may also determine
to which of the blood components the peptide is bound. This is particularly important
when using non-specific modified peptides. For specific maleimide-modified peptides,
it is much simpler to calculate the half life of serum albumin and IgG.
A. Immuno Assays
[0122] Another aspect of this invention relates to methods for determining the concentration
of the anti-viral peptides and/or analogs, or their derivatives and conjugates in
biological samples (such as blood) using antibodies specific for the peptides, peptide
analogs or their derivatives and conjugates, and to the use of such antibodies as
a treatment for toxicity potentially associated with such peptides, analogs, and/or
their derivatives or conjugates. This is advantageous because the increased stability
and life of the peptides in vivo in the patient might lead to novel problems during
treatment, including increased possibility for toxicity.
[0123] The use of anti-therapeutic agent antibodies, either monoclonal or polyclonal, having
specificity for a particular peptide, peptide analog or derivative thereof, can assist
in mediating any such problem. The antibody may be generated or derived from a host
immunized with the particular peptide, analog or derivative thereof, or with an immunogenic
fragment of the agent, or a synthesized immunogen corresponding to an antigenic determinant
of the agent. Preferred antibodies will have high specificity and affinity for native,
modified and conjugated forms of the peptide, peptide analog or derivative. Such antibodies
can also be labeled with enzymes, fluorochromes, or radiolables.
[0124] Antibodies specific for modified peptides may be produced by using purified peptides
for the induction of peptide-specific antibodies. By induction of antibodies, it is
intended not only the stimulation of an immune response by injection into animals,
but analogous steps in the production of synthetic antibodies or other specific binding
molecules such as screening of recombinant immunoglobulin libraries. Both monoclonal
and polyclonal antibodies can be produced by procedures well known in the art.
[0125] The anti-peptide antibodies may be used to treat toxicity induced by administration
of the modified peptide, analog or derivative thereof, and may be used ex vivo or
in vivo. Ex vivo methods would include immuno-dialysis treatment for toxicity employing
anti-therapeutic agent antibodies fixed to solid supports. In vivo methods include
administration of anti-therapeutic agent antibodies in amounts effective to induce
clearance of antibody-agent complexes.
[0126] The antibodies may be used to remove the modified peptides, analogs or derivatives
thereof, and conjugates thereof, from a patient's blood ex vivo by contacting the
blood with the antibodies under sterile conditions. For example, the antibodies can
be fixed or otherwise immobilized on a column matrix and the patient's blood can be
removed from the patient and passed over the matrix. The modified peptide, peptide
analogs, derivatives or conjugates will bind to the antibodies and the blood containing
a low concentration of peptide, analog, derivative or conjugate, then may be returned
to the patient's circulatory system. The amount of peptide compound removed can be
controlled by adjusting the pressure and flow rate.
[0127] Preferential removal of the peptides, analogs, derivatives and conjugates from the
plasma component of a patient's blood can be effected, for example, by the use of
a semipermeable membrane, or by otherwise first separating the plasma component from
the cellular component by ways known in the art prior to passing the plasma component
over a matrix containing the anti-therapeutic antibodies. Alternatively the preferential
removal of peptide-conjugated blood cells, including red blood cells, can be effected
by collecting and concentrating the blood cells in the patient's blood and contacting
those cells with fixed anti-therapeutic antibodies to the exclusion of the serum component
of the patient's blood.
[0128] The anti-therapeutic antibodies can be administered in vivo, parenterally, to a patient
that has received the peptide, analogs, derivatives or conjugates for treatment. The
antibodies will bind peptide compounds and conjugates. Once bound the peptide activity
will be hindered if not completely blocked thereby reducing the biologically effective
concentration of peptide compound in the patient's bloodstream and minimizing harmful
side effects. In addition, the bound antibody-peptide complex will facilitate clearance
of the peptide compounds and conjugates from the patient's blood stream.
[0129] The invention having been fully described can be further appreciated and understood
with reference to the following non-limiting examples.
Example 1
Preparation of a Modified DP178 --Synthesis of YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFK(MPA)-NH2
[0130] In this example, DP178 (SEQ ID NO:1) is synthesized and modified to include a linker
and maleimide group according to the following synthesis scheme. As reported in U.S.
Pat. Nos. 6,013,236 and 6,020,459, DP178 is a potent inhibitor of HIV-1, and inhibits
both cell-induced syncytia formation between HIV-1 infected and uninfected cells and
infection of uninfected cells be cell-free HIV-1 virus.
[0131] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-Phe-OH, Fmoc-Trp(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Trp(Boc)-OH,
Fmoc-Leu-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ala-OH, Fmoc-Trp(Boc)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asp(tBu)-OH,
Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH,
Fmoc-Glu(tBu)-OH, Fmoc-Met-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH,
Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH; Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH,
Fmoc-Asn(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Ser(tBu)-OH, Fmoc-His(Boc)-OH, Fmoc-Ile-OH, Fmoc-Leu-OH,
Fmoc-Ser(tBu)-OH, Fmoc-Thr(tBu)-OH, Fmoc-Tyr(tBu)-OH.They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl
-N, N, N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1). At the end of the synthesis.The
selective deprotection of the Lys (Aloc) group is performed manually and accomplished
by treating the resin with a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 2
Preparation of a Modified DP107-Synthesis of NNLLRAIEAQQHLLQLTVWQIKQLQARILAVERYLKDQK(MPA)NH2
[0132] In this example, DP107 (SEQ ID NO:2) is synthesized and modified to include a linker
and maleimide group according to the following synthesis scheme. As reported in U.S.
Pat. Nos. 6,013,236 and 6,020,459, DP107 exhibits potent antiviral activity against
HIV.
[0133] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Leu-OH,
Fmoc-Tyr(tBu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Val-OH, Fmoc-Ala-OH, Fmoc-Leu-OH,
Fmoc-Ile-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Ala-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Gln(Trt)-OH,
Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Val-OH, Fmoc-Thr(tBu)-OH,
Fmoc-Leu-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-His(Boc)-OH, Fmoc-Gln(Trt)-OH,
Fmoc-Gln(Trt)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Ala-OH, Fmoc-Arg(Pbf)-OH,
Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Asn(Trt)-OH, Fmoc-Asn(Trt)-OH,They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl
-N,N, N, N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1). At the end of the synthesis.The
selective deprotection of the Lys (Aloc) group is performed manually and accomplished
by treating the resin with a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 3
Preparation of a Modified anti-RSV peptide (C terminal)
[0134] In this example, the peptide VITIELSNIKENKCNGAKVKLIKQELDKYKNAV (SEQ ID NO:16) is
modified to include a linker and maleimide group according to the synthesis scheme
set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, the native
sequence (SEQ ID NO. ) inhibits viral infection of respiratory syncytial virus (RSV),
including inhibiting fusion and syncytia formation between RSV-infected and uninfected
Hep-2 cells.
[0135] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-Val-OH, Fmoc-Ala-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Tyr(tBu)-OH,
Fmoc-Lys(Boc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH,
Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Val-OH, Fmoc-Lys(Boc)-OH,
Fmoc-Ala-OH, Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH, Fmoc-Cys(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH,
Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH,
Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Val-OH.They
are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-
N, N, N', N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN-(B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 4
Preparation of a Modified anti-RSV peptide (T-N terminal)
[0136] In this example, the peptide VITIELSNIKENKCNGAKVKLIKQELDKYKNAV (SEQ ID NO:17), which
corresponds to the peptide of SEQ ID NO: 16 but where a Cysteine (C) has been substitututed
for the Methionine (M), residue is synthesized and modified to include a linker and
maleimide group according to the synthesis scheme set forth below. As reported in
U.S. Pat. Nos. 6,01-3,236 and 6,020,459, the native sequence (SEQ ID NO: 16) inhibits
viral infection of respiratory syncytial virus (RSV), including inhibiting fusion
and syncytia formation between RSV-infected and uninfected Hep-2 cells.
[0137] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Val-OH, Fmoc-Ala-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Lys(Boc)-OH,
Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Lys(Boc)-OH,
Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Val-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH,
Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH,
Fmoc-Met-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH,
Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Thr(tBu)-OH,
Fmoc-Ile-OH, Fmoc-Val-OH.They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl
-N, N, N', N-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1). The synthesis is then re-automated
for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling,
the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 5
Preparation of a Modified anti-RSV peptide
[0138] In this example, the peptide SEQ ID NO:14 is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO: 14 inhibits viral infection
of respiratory syncytial virus (RSV), including inhibiting fusion and syncytia formation
between RSV-infected and uninfected Hep-2 cells.
[0139] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asp(tBu)-OH,
Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Leu-OH,
Fmoc-Lys(Boc)-OH, Fmoc-Val-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH,
Fmoc-Cys(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH,
Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH,
Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Val-OH, Fmoc-Ser(tBu)-OH, Fmoc-Thr(tBu)-OH, Fmoc-Tyr(tBu)-OH.They
are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-
N, N, N, N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 6 (T-143)
Preparation of a Modified anti-RSV peptide
[0140] In this example, the peptide SEQ ID NO: 15 is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:15 inhibits viral infection
of respiratory syncytial virus (RSV), including inhibiting fusion and syncytia formation
between RSV-infected and uninfected Hep-2 cells.
[0141] Solid phase peptide synthesis of the modified peptide analog on a 100 µmole scale
is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and
Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially
added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Tyr(tBu)-OH,
Fmoc-Lys(Boc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH,
Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Val-OH, Fmoc-Lys(Boc)-OH,
Fmoc-Ala-OH, Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH, Fmoc-Cys(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH,
Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH,
Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Val-OH,
Fmoc-Ser(tBu)-OH, Fmoc-Thr(tBu)-OH.They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl
-N, N, N', N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 7
Preparation of a Modified anti-RSV peptide (C Terminal)
[0142] In this example, the peptide SEQ ID NO:17), which corresponds to SEQ ID NO:16 with
a cysteine (C) substituted for the Methionine (M), is synthesized and modified to
include a linker and maleimide group according to the synthesis scheme set forth below.
As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, the native sequence SEQ ID
NO:16. inhibits viral infection of respiratory syncytial virus (RSV), including inhibiting
fusion and syncytia formation between RSV-infected and uninfected Hep-2 cells.
[0143] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-Val-OH, Fmoc-Ala-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Tyr(tBu)-OH,
Fmoc-Lys(Boc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH,
Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Val-OH, Fmoc-Lys(Boc)-OH,
Fmoc-Ala-OH, Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH,
Fmoc-Met-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH,
Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Thr(tBu)-OH,
Fmoc-Ile-OH, Fmoc-Val-OH.They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-
N, N, N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 8
Preparation of a Modified anti-RSV peptide
[0144] In this example, the peptide SEQ ID NO:29. is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:29 inhibits viral infection
of respiratory syncytial virus (RSV), including inhibiting fusion and syncytia formation
between RSV-infected and uninfected Hep-2 cells.
[0145] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ile-OH, Fmoc-Tyr(tBu)-OH,
Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Leu-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Val-OH,
Fmoc-Lys(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Thr(tBu)-OH, Fmoc-Leu-OH, Fmoc-Val-OH, Fmoc-Ser(tBu)-OH,
Fmoc-Val-OH, Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Leu-OH, Fmoc-Ser(tBu)-OH,
Fmoc-Val-OH, Fmoc-Val-OH, Fmoc-Ala-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Thr(tBu)-OH,
Fmoc-Ser(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Ala-OH, Fmoc-Ile-OH.They are dissolved
in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl
-N, N, N', N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide

Example 9 (T-173)
Preparation of a Modified anti-HPIV peptide
[0146] In this example, the peptide SEQ ID NO:52. is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:52 inhibits viral infection
of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation
between HPIV3-infected Hep2 cells and uninfected CV-1W cells.
[0147] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Ile-OH,
Fmoc-Ser(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Val-OH, Fmoc-Ser(tBu)-OH,
Fmoc-Gln(Trt)-OH, Fmoc-Val-OH, Fmoc-Ala-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Thr(tBu)-OH,
Fmoc-Asp(tBu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Ile-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH,
Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ser(tBu)-OH,
Fmoc-Arg(Pbf)-OH, Fmoc-Ala-OH, Fmoc-Gln(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Val-OH.They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-
N, N, N', N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 10
Preparation of a Modified anti-HPIV peptide
[0148] In this example, the peptide SEQ ID NO:58 is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:58 inhibits viral infection
of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation
between HPIV3-infected Hep2 cells and uninfected CV-1W cells.
[0149] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-Val-OH, Fmoc-Ser(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Ala-OH,
Fmoc-Val-OH, Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Ile-OH,
Fmoc-Ser(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Val-OH, Fmoc-Ser(tBu)-OH,
Fmoc-Gln(Trt)-OH, Fmoc-Val-OH, Fmoc-Ala-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Thr(tBu)-OH,
Fmoc-Asp(tBu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Ile-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH,
Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ser(tBu)-OH,
Fmoc-Arg(Pbf)-OH. They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl
-N, N, N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 11
Preparation of a Modified anti-HPIV peptide
[0150] In this example, the peptide SEQ ID NO:35 is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:35 inhibits viral infection
of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation
between HPIV3-infected Hep2 cells and uninfected CV-1W cells.
[0151] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Asn(Trt)-OH,
Fmoc-Ser(tBu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Ile-OH, Fmoc-Trp(Boc)-OH,
Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Leu-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Lys(Boc)-OH,
Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Ile-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ile-OH,
Fmoc-Asp(tBu)-OH, Fmoc-Ile-OH, Fmoc-Pro-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Gln(Trt)-OH
Fmoc-Ala-OH, Fmoc-Val-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asn(Trt)-OH. They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-
N, N, N, N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 12
Preparation of a Modified anti-HPIV peptide
[0152] In this example, the peptide SEQ ID NO:38 is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO: 38 inhibits viral infection
of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation
between HPIV3-infected Hep2 cells and uninfected CV-1W cells.
[0153] Solid phase peptide synthesis of the modified peptide analog on a 100 µmole scale
is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and
Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially
added to resin: Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH,
Fmoc-Gln(Trt)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Arg(Pbf)-OH,
Fmoc-Ile-OH, Fmoc-Trp(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ser(tBu)-OH,
Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ser(tBu)-OH,
Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ile-OH, Fmoc-Pro-OH,
Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Ala-OH BOC-Lys(Aloc)-OH.They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl
-N, N, N, N-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 13
Preparation of a Modified anti-HPIV peptide
[0154] In this example, the peptide SEQ ID NO:39 is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:39 inhibits viral infection
of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation
between HPIV3-infected Hep2 cells and uninfected CV-1W cells.
[0155] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-Gly-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH,
Fmoc-Lys(Boc)-OH, Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Arg(Pbf)-OH,
Fmoc-Arg(Pbf)-OH, Fmoc-Ile-OH, Fmoc-Trp(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH,
Fmoc-Ser(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Asp(tBu)-OH,
Fmoc-Ser(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH,
Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asp(tBu)-OH,
Fmoc-Ile-OH, Fmoc-Pro-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH.They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl
-N, N, N, N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 14
Preparation of a Modified anti-HPIV peptide
[0156] In this example, the peptide SEQ ID NO:40 is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO. inhibits viral infection
of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation
between HPIV3-infected Hep2 cells and uninfected CV-1W cells.
[0157] Solid phase peptide synthesis of the modofied peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asp(tBu)-OH,
Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Arg(Pbf)-OH,
Fmoc-Arg(Pbf)-OH, Fmoc-Ile-OH, Fmoc-Trp(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH,
Fmoc-Ser(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Asp(tBu)-OH,
Fmoc-Ser(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH,
Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asp(tBu)-OH,
Fmoc-Ile-OH, Fmoc-Pro-OH, Fmoc-Asp(tBu)-OH.They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl
-N, N, N', N-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 15
Preparation of a Modified anti-HPIV peptide
[0158] In this example, the peptide SEQ ID NO:41 is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:41 inhibits viral infection
of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation
between HPIV3-infected Hep2 cells and uninfected CV-1W cells.
[0159] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Trp(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asp(tBu)-OH,
Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Arg(Pbf)-OH,
Fmoc-Arg(Pbf)-OH, Fmoc-Ile-OH, Fmoc-Trp(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH,
Fmoc-Ser(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Asp(tBu)-OH,
Fmoc-Ser(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH,
Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asp(tBu)-OH,
Fmoc-Ile-OH, Fmoc-Pro-OH Boc-Lys(Aloc)-OH,. They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl
-N, N, N', N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 16
Preparation of a Modified anti-HPIV peptide
[0160] In this example, the peptide SEQ ID NO:42 is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:42 inhibits viral infection
of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation
between HPIV3-infected Hep2 cells and uninfected CV-1W cells.
[0161] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-His(Boc)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH,
Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gly-OH,
Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Ile-OH,
Fmoc-Trp(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Lys(Boc)-OH,
Fmoc-Ala-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH,
Fmoc-Ser(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ile-OH. They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl
-N, N, N', N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC

Example 17
Preparation of a Modified anti-MeV peptide
[0162] In this example, the peptide SEQ ID NO:77. is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:77 inhibits viral infection
of measles virus (MeV), including inhibiting fusion and syncytia formation between
MeV-infected and uninfected Vero cells.
[0163] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH,
Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Ile-OH,
Fmoc-Ala-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Leu-OH, Fmoc-Asn(Trt)-OH, Fmoc-Thr(tBu)-OH,
Fmoc-Gly-OH, Fmoc-Val-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Leu-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ile-OH, Fmoc-Pro-OH, Fmoc-Pro-OH, Fmoc-Gly-OH,
Fmoc-Leu-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ile-OH, Fmoc-Arg(Pbf)-OH, Fmoc-His(Boc)-OH. They
are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-
N, N, N', N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 18
Preparation of a Modified anti-MeV peptide
[0164] In this example, the peptide SEQ ID NO:79 is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:79 inhibits viral infection
of measles virus (MeV), including inhibiting fusion and syncytia formation between
MeV-infected and uninfected Vero cells.
[0165] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH,
Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH,
Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Ile-OH, Fmoc-Ala-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH,
Fmoc-Leu-OH, Fmoc-Asn(Trt)-OH, Fmoc-Thr(tBu)-OH, Fmoc-Gly-OH, Fmoc-Val-OH, Fmoc-Asp(tBu)-OH,
Fmoc-Leu-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ile-OH,
Fmoc-Pro-OH, Fmoc-Pro-OH, Fmoc-Gly-OH, Fmoc-Leu-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ile-OH,
They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-
N, N, N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC

Example 19
Preparation of a Modified anti-MeV peptide
[0166] In this example, the peptide SEQ ID NO:81 is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO: 79 inhibits viral infection
of measles virus (MeV), including inhibiting fusion and syncytia formation between
MeV-infected and uninfected Vero cells.
[0167] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Asp(tBu)-OH,Fmoc-Ser(tBu)-OH, Fmoc-Ser(tBu)-OH,
Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH,
Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Ile-OH, Fmoc-Ala-OH,
Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Leu-OH, Fmoc-Asn(Trt)-OH, Fmoc-Thr(tBu)-OH, Fmoc-Gly-OH,
Fmoc-Val-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH,
Fmoc-Ser(tBu)-OH, Fmoc-Ile-OH, Fmoc-Pro-OH, Fmoc-Pro-OH, Fmoc-Gly-OH, Fmoc-Leu-OH.
They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-
N, N, N, N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 20
Preparation of a Modified anti-MeV peptide
[0168] In this example, the peptide SEQ ID NO:84 is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:84 inhibits viral infection
of measles virus (MeV), including inhibiting fusion and syncytia formation between
MeV-infected and uninfected Vero cells.
[0169] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Leu-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Asp(tBu)-OH,Fmoc-Ser(tBu)-OH,
Fmoc-Ser(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH,
Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Ile-OH,
Fmoc-Ala-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Leu-OH, Fmoc-Asn(Trt)-OH, Fmoc-Thr(tBu)-OH,
Fmoc-Gly-OH, Fmoc-Val-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Leu-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ile-OH, Fmoc-Pro-OH. They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl
-N, N, N', N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 21
Preparation of a Modified anti-SIV peptide
[0170] In this example, the peptide SEQ ID NO:64 is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:64. exhibits potent
antiviral activity as a crude peptide against simian immunodeficiency virus (SIV).
[0171] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Ala-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH,
Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Phe-OH, Fmoc-Asp(tBu)-OH,
Fmoc-Val-OH, Fmoc-Lys(Boc)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Trp(Boc)-OH,
Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Trp(Boc)-OH. They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,
N, N', N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 22
Preparation of a Modified anti-SIV peptide
[0172] In this example, the peptide SEQ ID NO:65 is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:65 exhibits potent antiviral
activity as a crude peptide against simian immunodeficiency virus (SIV).
[0173] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Ala-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH,
Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Phe-OH, Fmoc-Asp(tBu)-OH,
Fmoc-Val-OH, Fmoc-Lys(Boc)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Trp(Boc)-OH,
Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH. They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-
N, N, N, N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 23
Preparation of a Modified anti-SIV peptide
[0174] In this example, the peptide SEQ ID NO:66 is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:66 exhibits potent antiviral
activity as a crude peptide against simian immunodeficiency virus (SIV).
[0175] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Ala-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH,
Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Phe-OH, Fmoc-Asp(tBu)-OH,
Fmoc-Val-OH, Fmoc-Lys(Boc)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Trp(Boc)-OH,
Fmoc-Glu(tBu)-OH Boc-Lys(Aloc)-OH,. They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl
-N, N, N', N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 24
Preparation of a Modified anti-SIV peptide
[0176] In this example, the peptide SEQ ID NO:67 is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:67 exhibits potent antiviral
activity as a crude peptide against simian immunodeficiency virus (SIV).
[0177] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH,
Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH,
Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH,
Fmoc-Gln(Trt)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH,
Fmoc-Ala-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Leu-OH, Fmoc-Phe-OH, Fmoc-Asp(tBu)-OH, Fmoc-Val-OH, Fmoc-Lys(Boc)-OH, Fmoc-Arg(Pbf)-OH,
Fmoc-Glu(tBu)-OH, Fmoc-Trp(Boc)-OH. They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl
-N, N, N', N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 25
Preparation of a Modified anti-SIV peptide
[0178] In this example, the peptide SEQ ID NO:68 is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:68 exhibits potent antiviral
activity as a crude peptide against simian immunodeficiency virus (SIV).
[0179] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Trp(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH,
Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH,
Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH,
Fmoc-Gln(Trt)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH,
Fmoc-Ala-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Leu-OH, Fmoc-Phe-OH, Fmoc-Asp(tBu)-OH, Fmoc-Val-OH, Fmoc-Lys(Boc)-OH, Fmoc-Arg(Pbf)-OH,
Fmoc-Glu(tBu)-OH Boc-Lys(Aloc)-OH,. They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-
N, N, N', N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloe) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 26
Preparation of a Modified anti-SIV peptide
[0180] In this example, the peptide SEQ ID NO:69 is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:69 exhibits potent antiviral
activity as a crude peptide against simian immunodeficiency virus (SIV).
[0181] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asn(Trt)-OH,
Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH,
Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH,
Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Ala-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH,
Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Phe-OH, Fmoc-Asp(tBu)-OH, Fmoc-Val-OH,
Fmoc-Lys(Boc)-OH, Fmoc-Arg(Pbf)-OH. They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl
-N, N, N', N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 27
Preparation of a Modified anti-SIV peptide
[0182] In this example, the peptide SEQ ID NO:70. is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:70 exhibits potent antiviral
activity as a crude peptide against simian immunodeficiency virus (SIV).
[0183] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Val-OH, Fmoc-Asp(tBu)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asn(Trt)-OH,
Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH,
Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH,
Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Ala-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH,
Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Phe-OH, Fmoc-Asp(tBu)-OH, Fmoc-Val-OH,
Fmoc-Lys(Boc)-OH, Boc-Lys(Aloc)-OH,. They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl
-N, N, N', N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 28
Preparation of a Modified anti-SIV peptide
[0184] In this example, the peptide SEQ ID NO:71 is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:71 exhibits potent antiviral
activity as a crude peptide against simian immunodeficiency virus (SIV).
[0185] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-Phe-OH, Fmoc-Val-OH, Fmoc-Asp(tBu)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Ser(tBu)-OH,
Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Ala-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH,
Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Phe-OH, Fmoc-Asp(tBu)-OH,
Fmoc-Val-OH. They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl
-N, N, N, N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 29
Preparation of a Modified anti-SIV peptide
[0186] In this example, the peptide SEQ ID NO:72 is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:72 exhibits potent antiviral
activity as a crude peptide against simian immunodeficiency virus (SIV).
[0187] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-Gly-OH, Fmoc-Phe-OH, Fmoc-Val-OH, Fmoc-Asp(tBu)-OH, Fmoc-Trp(Boc)-OH,
Fmoc-Ser(tBu)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH,
Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH,
Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH,
Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Ala-OH,
Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Leu-OH, Fmoc-Phe-OH, Fmoc-Asp(tBu)-OH. They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl
-N, N, N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

Example 30
Preparation of a Modified anti-SIV peptide
[0188] In this example, the peptide SEQ ID NO:73 is synthesized and modified to include
a linker and maleimide group according to the synthesis scheme set forth below. As
reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:73 exhibits potent antiviral
activity as a crude peptide against simian immunodeficiency virus (SIV).
[0189] Solid phase peptide synthesis of the modified peptide on a 100 µmole scale is performed
using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected
Rink Amide MBHA. The following protected amino acids are sequentially added to resin:
Fmoc-Lys(Aloc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Phe-OH, Fmoc-Val-OH, Fmoc-Asp(tBu)-OH,
Fmoc-Trp(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH,
Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH,
Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH,
Fmoc-Gln(Trt)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH,
Fmoc-Ala-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH,
Fmoc-Leu-OH, Fmoc-Phe-OH. They are dissolved in
N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-
N, N, N', N'-tetramethyl-uroniurn hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine
in
N,N-dimethylformamide (DMF) for 20 minutes (step 1).The selective deprotection of the
Lys (Aloc) group is performed manually and accomplished by treating the resin with
a solution of 3 eq of Pd(PPh
3)
4 dissolved in 5 mL of CHCl
3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl
3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL). The synthesis
is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between
every coupling, the resin is washed 3 times with
N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from
the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation
by dry-ice cold Et
2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian
(Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA
in H
2O (A) and 0.045% TFA in CH
3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 µ phenyl-hexyl, 21 mm
x 25 cm column and UV detector (Varian Dynamax UVD II) at λ 214 and 254 nm to afford
the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
