CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims priority to U.S. patent application number
61/378,911, filed August 31, 2010, U.S. patent application number
61/389,922, filed October 5, 2010, U.S. patent application number
61/390,995, filed October 7, 2010, U.S. patent application number
61/420,703, filed December 7, 2010, U.S. patent application number
61/487,527, filed May 18, 2011, U.S. patent application no.
61/492,338, filed June 1, 2011, and U.S. patent application number
61/503,489, filed June 30, 2011, the contents of which are incorporated herein by reference
in their entirety.
SEQUENCE LISTING
[0002] This application contains a Sequence Listing which has been submitted in ASCII format
via EFS-WEB and is hereby incorporated by reference in its entirety. Said ASCII copy,
created on August 20, 2011, is named P4492R1U.txt and is 16,513 bytes in size.
FIELD OF THE INVENTION
[0003] The present invention concerns cancer biomarkers. In particular, the invention concerns
c-met as a biomarker for patient selection and prognosis in cancer, as well as methods
of therapeutic treatment, articles of manufacture and methods for making them, diagnostic
kits, methods of detection and methods of advertising related thereto.
BACKGROUND
[0004] Cancer remains to be one of the most deadly threats to human health. In the U.S.,
cancer affects nearly 1.3 million new patients each year, and is the second leading
cause of death after heart disease, accounting for approximately 1 in 4 deaths. For
example, breast cancer is the second most common form of cancer and the second leading
cancer killer among American women. It is also predicted that cancer may surpass cardiovascular
diseases as the number one cause of death within 5 years. Solid tumors are responsible
for most of those deaths. Although there have been significant advances in the medical
treatment of certain cancers, the overall 5-year survival rate for all cancers has
improved only by about 10% in the past 20 years. Cancers, or malignant tumors, metastasize
and grow rapidly in an uncontrolled manner, making timely detection and treatment
extremely difficult.
[0005] Despite the significant advancement in the treatment of cancer, improved therapies
are still being sought.
[0006] All references cited herein, including patent applications and publications, are
incorporated by reference in their entirety.
SUMMARY OF THE INVENTION
[0007] Uses of a c-met antagonist for effectively treating cancer patients are provided.
This application also provides better methods for diagnosing disease for use in treating
the disease optionally with c-met antagonist. In particular, the invention provides
data from a randomized phase II clinical trial of anti-c-met antibody MetMAb (onartuzumab)
in combination with erlotinib (TARCEVA®) in subjects with second- and third-line non-small
cell lung cancer (NSCLC). C-met biomarker was used to identify a patient population
in which MetMAb plus erlotinib treatment provided clinically meaningful benefit, evaluated
by progression-free survival and overall survival, and a patient population in which
MetMAb plus erlotinib treatment significantly increased the risk of cancer progression
and death (compared to treatment with erlotinib alone). This worse outcome underscores
the need to select patients who will benefit from treatment with c-met antagonist
(e.g., in combination with EGFR antagonist).
[0008] In the clinical trial, treatment with MetMAb and erlotinib provided a clinically
meaningful benefit to patients with NSCLC that expressed high levels of c-met biomarker.
The results showed that the efficacy, as evaluated by progression free survival (PFS)
and overall survival (OS), was positive especially when compared to PFS and OS data
for erlotinib treatment alone. The difference was statistically significant, and the
addition of MetMAb to erlotinib nearly doubled the progression free and overall survival
in patients with NSCLC that expressed high levels of c-met biomarker. The clinical
trial data also showed that treatment with MetMAb in combination with erlotinib increased
the risk of progression and death in patients with NSCLC that expressed low levels
of c-met biomarker, relative to risk of progression and death in such patients treated
with erlotinib alone. The results showed that the efficacy, as evaluated by PFS and
OS, was worse in the MetMAb and erlotinib treated patients when compared with PFS
and OS data for erlotinib treatment alone. The difference was statistically significant.
[0009] The clinical trial data also showed that high (also termed "elevated") c-met expression
was strongly associated with a worse prognosis in erlotinib-treated NSCLC patients.
Patients with NSCLC that expressed high c-met biomarker had increased risk of progression
and approximately double the risk of death relative to patients with NSCLC that expressed
low c-met biomarker. Thus, high c-met expression was a strongly significant prognostic
factor for progression and survival in erlotinib-treated second- or third-line NSCLC
patients.
[0010] In one aspect, the invention provides methods for identifying a cancer patient who
is likely to respond to treatment with a c-met antagonist comprising the step of determining
whether the patient's cancer has a high amount of c-met biomarker, wherein the c-met
biomarker expression indicates that the patient is likely to respond to treatment
with the c-met antagonist. As used herein, "elevated" or "high" c-met refers to an
amount of c-met associated with patient responsiveness to a treatment.
[0011] In another aspect, the invention provides methods for determining cancer patient
prognosis, comprising the step of determining whether the patient's cancer has a high
amount of c-met biomarker, wherein the c-met biomarker expression indicates that the
patient is likely to have increased overall survival (OS) and/or progression-free
survival (PFS) when the patient is treated with a c-met antagonist.
[0012] In another aspect, the invention provides methods for determining c-met biomarker
expression, comprising the step of determining whether a patient's cancer has a high
amount of c-met biomarker, wherein c-met biomarker expression is protein expression
and is determined in a sample from the patient using IHC, wherein high c-met biomarker
expression is 50% or more of the tumor cells with moderate c-met staining intensity,
combined moderate/high c-met staining intensity or high c-met staining intensity,
wherein c-met expression is detected using a c-met antibody, wherein the c-met biomarker
expression indicates that the patient is likely to have increased OS and/or PFS when
the patient is treated with a c-met antagonist.
[0013] In one aspect, the invention provides a method of determining patient prognosis,
comprising determining amount of c-met biomarker in a patient cancer sample. In some
embodiments, high c-met biomarker expression means increased PFS and/or OS when the
patient is treated with a combination of anti-c-met antibody and erlotinib. In some
embodiments, low c-met biomarker expression means decreased PFS and/or OS when the
patient is treated with a combination of anti-c-met antibody and erlotinib.
[0014] In one aspect, the invention provides a method of optimizing therapeutic efficacy
comprising determining amount of c-met biomarker expression in a patient cancer sample.
[0015] In some embodiments of the methods of the invention involving high c-met biomarker
expression, c-met biomarker protein expression is determined in a sample from the
patient using immunohistochemistry (IHC). In some embodiments, the IHC score is 2
or 3. In some embodiments, the IHC score is 2. In some embodiments, the IHC score
is 3. In some embodiments, high c-met biomarker expression is 50% or more of the tumor
cells with moderate c-met staining intensity, combined moderate/high c-met staining
intensity or high c-met staining intensity. In some embodiments, c-met expression
staining intensity is determined relative to c-met staining intensity of control cell
pellets. In some embodiments, cell line A549 has moderate c-met staining intensity.
In some embodiments, cell line H441 has strong c-met staining intensity. In some embodiments,
c-met biomarker expression is nucleic acid expression and is determined in a sample
from the patient using gene expression profiling, PCR (such as rtPCR), RNN-seq, microarray
analysis, SAGE, MassARRAY technique, or FISH. In some embodiments, the patient whose
cancer has high amounts of c-met biomarker has increased likelihood of greater PFS
and/or OS relative to a patient whose cancer does not have high c-met biomarker. In
some embodiments of any of the inventions disclosed herein, high c-met biomarker expression
is met diagnostic positive (met diagnostic positive clinical status) as defined in
accordance with Table A herein.
[0016] In another aspect, the invention provides methods for identifying a cancer patient
who is less likely to be respond to treatment with a c-met antagonist comprising the
step of determining whether the patient's cancer has a low amount of c-met biomarker,
wherein the c-met biomarker expression indicates that the patient is less likely to
respond to treatment with the c-met antagonist. As used herein, a "low" amount of
c-met refers to an amount of c-met associated with lack of response to a treatment,
or, in some embodiments, an amount of c-met associated with worse response to a treatment
(e.g. decreased clinical benefit compared to no treatment). In some embodiments, c-met
biomarker expression is protein expression and is determined in a sample from the
patient using immunohistochemistry (IHC). In some embodiments, the IHC score is 1
or 0. In some embodiments, the IHC score is 1. In some embodiments, the IHC score
is 0. In some embodiments, low c-met biomarker expression is negative c-met staining,
less than 50% of tumor cells with weak or combined weak and moderate c-met staining
intensity, or 50% or more tumor cells with weak or combined weak and moderate c-met
staining intensity but less than 50% tumor cells with moderate or combined moderate
and strong c-met staining intensity. In some embodiments, c-met expression staining
intensity is determined relative to c-met staining intensity of control cell pellets.
In some embodiments, cell line H1155 has negative c-met staining intensity. In some
embodiments, cell line HEK-293 has low c-met staining intensity. In some embodiments
of any of the inventions disclosed herein, low c-met biomarker expression is met diagnostic
negative (met diagnostic negative clinical status) as defined in accordance with Table
A herein.
[0017] According to one embodiment, the invention concerns methods for treating a patient
with cancer comprising administering a therapeutically effective amount of a c-met
antagonist to the patient if the patient has been found to have an elevated (high)
amount of c-met (i.e. expression high c-met biomarker).
[0018] In one aspect, the invention provides methods for treating a patient with cancer
comprising administering a therapeutically effective amount of a c-met antagonist
to the patient if the patient has been found to have a high amount of a c-met biomarker.
In some embodiments, the patient's cancer has been found to have a high amount of
a c-met biomarker. In some embodiments, the c-met antagonist is an anti-c-met antibody.
In some embodiments, the anti-c-met antibody is MetMAb (onartuzumab). In some embodiments,
c-met biomarker protein expression is determined in a sample from the patient using
immunohistochemistry (IHC). In some embodiments, IHC score is 2 or 3. In some embodiments,
the IHC score is 2. In some embodiments, the IHC score is 3. In some embodiments,
high c-met biomarker expression is 50% or more of the tumor cells with moderate c-met
staining intensity, combined moderate/high c-met staining intensity or high c-met
staining intensity. In some embodiments, c-met expression staining intensity is determined
relative to c-met staining intensity of control cell pellets. In some embodiments,
cell line A549 has moderate c-met staining intensity. In some embodiments, cell line
H441 has strong c-met staining intensity. In some embodiments, c-met biomarker expression
is nucleic acid expression and is determined in a sample from the patient using gene
expression profiling, PCR (such as rtPCR), RNN-seq, microarray analysis, SAGE, MassARRAY
technique, or FISH. In some embodiments, the patient has (has greater likelihood of)
greater PFS and/or OS relative to a patient who does not have high c-met biomarker.
In some embodiments of any of the inventions disclosed herein, high c-met biomarker
expression is met diagnostic positive clinical status as defined in accordance with
Table A herein.
[0019] In addition, the invention concerns methods for treating a patient with cancer comprising
administering to the patient a therapeutically effective amount of a cancer medicament
other than a c-met antagonist, if the patient has been found to have a low (i.e.,
low or substantially undetectable) amount of c-met biomarker.
[0020] In another aspect, the invention provides methods for treating a patient with cancer
comprising administering a therapeutically effective amount of a cancer medicament
other than a c-met antagonist to the patient who has been found to express low c-met
biomarker (i.e., have a low amount of c-met biomarker). In some embodiments, the patient's
cancer has been found to express low c-met biomarker. In some embodiments, c-met biomarker
protein expression is determined in a sample from the patient using immunohistochemistry
(IHC). In some embodiments, the IHC score is 1 or 0. In some embodiments, the IHC
score is 1. In some embodiments, the IHC score is 0. In some embodiments, low c-met
biomarker expression is detected by the presence of negative c-met staining, less
than 50% of tumor cells with weak or combined weak and moderate c-met staining intensity,
or 50% or more tumor cells with weak or combined weak and moderate c-met staining
intensity but less than 50% tumor cells with moderate or combined moderate and strong
c-met staining intensity. In some embodiments, c-met expression staining intensity
is determined relative to c-met staining intensity of control cell pellets. In some
embodiments, cell line H1155 has negative c-met staining. In some embodiments, cell
line HEK-293 has low c-met staining intensity. In some embodiments of any of the inventions
disclosed herein, low c-met biomarker expression is met diagnostic negative clinical
status as defined in accordance with Table A herein.
[0021] The invention also relates to methods for selecting a therapy for a patient with
cancer comprising determining expression of c-met biomarker in a sample from the patient,
and selecting a cancer medicament based on the level of expression of the biomarker.
In one embodiment, the patient is selected for treatment with a c-met antagonist (e.g.,
anti-c-met antibody) if the cancer sample expresses c-met biomarker at a high level.
In some embodiments, the patient is treated for cancer using therapeutically effective
amount of the c-met antagonist. Thus, in some embodiments, the patient is selected
for treatment with a c-met antagonist (e.g., anti-c-met antibody) if the patient's
cancer sample expresses c-met biomarker at a high level, and (following the selection)
the patient is treated for cancer using therapeutically effective amount of the c-met
antagonist. In another embodiment, the patient is selected for treatment with a cancer
medicament other than c-met antagonist if the cancer sample expresses c-met biomarker
at a low level (e.g., the cancer sample expresses low or substantially undetectable
levels of the biomarker). In some embodiments, the patient is treated for cancer using
therapeutically effective amounts of the cancer medicament other than c-met antagonist.
Thus, in some embodiments, the patient is selected for treatment with a cancer medicament
other than c-met antagonist (e.g., EGFR antagonist, e.g., erlotinib) if the cancer
sample expresses c-met biomarker at a low (i.e., low or substantially undetectable)
level, and (following the selection) the patient is treated for cancer using therapeutically
effective amount of the c-met antagonist.
[0022] Moreover, the invention concerns methods for advertising a cancer medicament (e.g.,
a c-met antagonist) comprising promoting, to a target audience, the use of the cancer
medicament for treating a patient with cancer based on expression of c-met biomarker.
Promotion may be conducted by any means available. In some embodiments, the promotion
is by a package insert accompanying a commercial formulation of the c-met antagonist
(such as an anti-c-met antibody). The promotion may also be by a package insert accompanying
a commercial formulation of a second medicament (when treatment is combination therapy
with a c-met antagonist and a second medicament, e.g., an EGFR antagonist such as
erlotinib). Promotion may be by written or oral communication to a physician or health
care provider. In some embodiments, the promotion is by a package insert where the
package insert provides instructions to receive therapy with c-met antagonist, and
in some embodiments, in combination with a second medicament, such as an EGFR antagonist
(such as erlotinib) or, in other embodiments, an anti-VEGF antibody. In some embodiments,
the promotion is followed by the treatment of the patient with the c-met antagonist
with or without the second medicament (e.g., erlotinib). In some embodiments, the
promotion is followed by the treatment of the patient with the second medicament with
or without treatment with c-met antagonist. In some embodiments, the package insert
indicates that the c-met antagonist is to be used to treat the patient if the patient's
cancer sample expressed high c-met biomarker. In some embodiments, the package insert
indicates that the c-met antagonist is not to be used to treat the patient if the
patient's cancer sample expresses low c-met biomarker. In some embodiments, high c-met
biomarker means likelihood of increased PFS and/or OS when the patient is treated
with the c-met antagonist (or in some embodiments, treated with c-met antagonist in
combination with EGFR antagonist). In some embodiments, low c-met biomarker means
likelihood of decreased PFS and OS when the patient is treated with the c-met antagonist
(or in some embodiments, treated with c-met antagonist in combination with EGFR antagonist).
In some embodiments, the PFS and/or OS is decreased relative to a patient who is not
treated with the c-met antagonist (or in some embodiments, treated with c-met antagonist
in combination with EGFR antagonist). In some embodiments, the promotion is by a package
insert where the package inset provides instructions to receive therapy with anti-c-met
antibody in combination with an EGFR antagonist. In some embodiments, the promotion
is followed by the treatment of the patient with the anti-c-met antibody with or without
the second medicament.
[0023] In some aspects, the invention features methods of instructing a patient with cancer
(such as NSCLC) expressing high levels of c-met biomarker by providing instructions
to receive treatment with a c-met antagonist (for example, an anti-c-met antibody),
and in some embodiments, treatment with a second medicament (such as EGFR antagonist,
e.g. erlotinib), for example, to increase survival of the patient, to decrease the
patient's risk of cancer recurrence and/or to increase the patient's likelihood of
survival. In some embodiments, the treatment comprises administering to the NSCLC
patient an anti-c-met antibody (e.g., MetMAb) administered in combination with an
EGFR antagonist, such as erlotinib. In some embodiments the method further comprises
providing instructions to receive treatment with at least one chemotherapeutic agent.
In certain embodiments the patient is treated as instructed by the method of instructing.
In some embodiments, the package insert indicates that the c-met antagonist is to
be used to treat the patient if the patient's cancer sample expressed high c-met biomarker.
In some embodiments, the instructions indicate that the c-met antagonist is not to
be used to treat the patient if the patient's cancer sample expresses low c-met biomarker,
wherein low c-met biomarker means decreased PFS and OS when the patient is treated
with the c-met antagonist (or in some embodiments, treated with c-met antagonist in
combination with EGFR antagonist). In some embodiments, the PFS and/or OS is decreased
relative to a patient who is not treated with the c-met antagonist (or in some embodiments,
treated with c-met antagonist in combination with EGFR antagonist).
[0024] The invention also provides business methods, comprising marketing an c-met antagonist
(e.g., anti-c-met antibody) for treatment of cancer (e.g., NSCLC) in a human patient,
wherein the patient's cancer expressed high (elevated) c-met biomarker expression,
for example, to increase survival, decrease the patient's likelihood of cancer recurrence,
and/or increase the patient's likelihood of survival. In some embodiments, the treatment
comprises administering to a cancer patient an anti-c-met antibody (e.g., MetMAb),
and in some embodiment, a second medicament (e.g., an EGFR antagonist, such as erlotinib).
In some embodiments, the marketing is followed by the treatment of the patient with
the c-met antagonist (such as anti-c-met antibody) and in some embodiments, treatment
with anti-c-met antibody and/or EGFR antagonist. In some aspects, the invention features
a method of instructing a patient with cancer (such as NSCLC) expressing low (i.e.,
low or substantially undetectable) levels of c-met biomarker by providing instructions
to receive treatment with a cancer medicament other than a c-met antagonist. In certain
embodiments the patient is treated as instructed by the method of instructing.
[0025] In one aspect, the invention provides a c-met antagonist for use for the treatment
of a cancer patient, wherein the patient expresses a high amount of c-met biomarker.
In some embodiments, the patient's cancer expresses a high amount of c-met biomarker.
[0026] In one aspect, the invention provides in vitro use of a c-met IHC assay for identifying
a cancer patient suitable for treatment with a c-met antagonist, wherein the patient
expresses a high amount of c-met biomarker. In some embodiments, the patient's cancer
expresses a high amount of c-met biomarker.
[0027] In one aspect, the invention provides diagnostic kits comprising one or more reagent
for determining expression of a c-met biomarker in a sample from a cancer (e.g., NSCLC)
patient. The diagnostic kit is suitable for use with any of the methods described
herein. In some embodiments, detection of high c-met biomarker means increased PFS
and/or OS when the patient is treated with a c-met antagonist. In some embodiments,
detection of low c-met biomarker means a decreased PFS and/or OS when the patient
is treated with the c-met antagonist. In some embodiments, the kit further comprises
instructions to use the kit to select a c-met medicament to treat the NSCLC patient.
[0028] In one aspect, the invention provides use of a diagnostic kit for identifying a cancer
patient suitable for treatment with a c-met antagonist, wherein the patient expresses
a high amount of c-met biomarker. In some embodiments, the patient's cancer expresses
a high amount of c-met biomarker.
[0029] The invention also concerns articles of manufacture comprising, packaged together,
a c-met antagonist in a pharmaceutically acceptable carrier and a package insert indicating
that the c-met antagonist is for treating a patient with cancer based on expression
of c-met biomarker. Treatment methods include any of the treatment methods disclosed
herein. In some embodiments, the package insert indicates that the c-met antagonist
is to be used to treat the patient if the patient's cancer sample expressed high c-met
biomarker. In some embodiments, the PFS and/or OS is likely increased relative to
a patient who is not treated with the c-met antagonist (or in some embodiments, treated
with c-met antagonist in combination with EGFR antagonist). In some embodiments, the
package insert indicates that the c-met antagonist is not to be used to treat the
patient if the patient's cancer sample expresses low c-met biomarker. In some embodiments,
low c-met biomarker means decreased PFS and OS when the patient is treated with the
c-met antagonist (or in some embodiments, treated with c-met antagonist in combination
with EGFR antagonist). In some embodiments, the PFS and/or OS is likely decreased
relative to a patient who is not treated with the c-met antagonist (or in some embodiments,
treated with c-met antagonist in combination with EGFR antagonist).
[0030] In a related aspect, the invention concerns methods for manufacturing an article
of manufacture comprising combining in a package a pharmaceutical composition comprising
a cancer medicament and a package insert indicating that the pharmaceutical composition
is for treating a patient with cancer based on expression of c-met biomarker. Treatment
methods include any of the treatment methods disclosed herein. In some embodiments,
the package insert indicates that the c-met antagonist is to be used to treat the
patient if the patient's cancer sample expressed high c-met biomarker. In some embodiments,
the package insert indicates that the c-met antagonist is not to be used to treat
the patient if the patient's cancer sample expresses low c-met biomarker. In some
embodiments, low c-met biomarker means increased likelihood of decreased PFS and OS
when the patient is treated with the c-met antagonist (or in some embodiments, treated
with c-met antagonist in combination with EGFR antagonist). In some embodiments, the
PFS and/or OS is decreased relative to a patient who is not treated with the c-met
antagonist (or in some embodiments, treated with c-met antagonist in combination with
EGFR antagonist).
[0031] In certain embodiments of any of the inventions described herein, the cancer may
be non-small cell lung cancer (including e.g., squamous cell carcinoma (SCC)), renal
cell cancer, pancreatic cancer, gastric carcinoma, bladder cancer, esophageal cancer,
mesothelioma, melanoma, breast cancer (including triple-negative breast cancer), thyroid
cancer, colorectal cancer, head and neck cancer, osteosarcoma, prostate cancer, or
glioblastoma. In some embodiments, the cancer is NSCLC. In some embodiments, the NSCLC
is second-line or third-line locally advanced or metastatic non-small cell lung cancer.
In some embodiments, the NSCLC is adenocarcinoma. In some embodiments, the NSCLC is
squamous cell carcinoma. Other exemplary cancers are described herein. In some embodiments,
the NSCLC is locally advanced or metastatic NSCLC after failure of at least one prior
chemotherapy regimen.
[0032] In certain embodiments of any of the inventions provided herein, the patient did
not receive more than two prior treatments for Stage IIIB/IV. In some embodiments,
the patient did not receive more than 30 days of exposure to an investigational or
marketed agent that can act by EGFR inhibition, or a known EGFR-related toxicity resulting
in dose modifications. EGFR inhibitors include (but are not limited to) gefitinib,
erlotinib, and cetuximab. In some embodiments, the patient did not receive chemotherapy,
biologic therapy, radiotherapy or investigational drug within 28 days prior to randomization
(except that optionally, kinase inhibitors may be used within two weeks prior to randomization
provided any drug related toxicity was adequately resolved). In some embodiments,
the patient is not a patient with untreated and/or active (progressing or requiring
anticonvulsants or corticosteroids for symptomatic control) CNS metastasis. In some
embodiments, a sample of the patient's cancer has been shown to have wildtype EGFR.
In some embodiments, a sample of the patient's cancer has not been shown to have mutated
EGFR. Other patient exclusion criteria are described in the Examples, and the present
inventions contemplate use of one or more of the exclusions described therein.
[0033] C-met antagonists, e.g., suitable for use in any of the inventions described herein,
are known in the art and some are further described herein. In certain embodiments,
the c-met antagonist is an antagonist anti-c-met antibody. In certain embodiments,
the anti-c-met antibody comprises a (a) HVR1 comprising sequence GYTFTSYWLH (SEQ ID
NO: 1); (b) HVR2 comprising sequence GMIDPSNSDTRFNPNFKD (SEQ ID NO: 2); (c) HVR3-HC
comprising sequence ATYRSYVTPLDY (SEQ ID NO: 3); (d) HVR1-LC comprising sequence KSSQSLLYTSSQKNYLA
(SEQ ID NO: 4); (e) HVR2-LC comprising sequence WASTRES (SEQ ID NO: 5); and (f) HVR3-LC
comprising sequence QQYYAYPWT (SEQ ID NO: 6). In certain embodiments, the anti-c-met
antibody is monovalent and comprises (a) a first polypeptide comprising a heavy chain,
said polypeptide comprising the sequence of SEQ ID NO: 11; (b) a second polypeptide
comprising a light chain, the polypeptide comprising the sequence of SEQ ID NO: 12;
and a third polypeptide comprising a Fc sequence, the polypeptide comprising the sequence
of SEQ ID NO: 13, wherein the heavy chain variable domain and the light chain variable
domain are present as a complex and form a single antigen binding arm, wherein the
first and second Fc polypeptides are present in a complex and form a Fc region that
increases stability of said antibody fragment compared to a Fab molecule comprising
said antigen binding arm. In certain embodiments, the c-met antibody is MetMAb (interchangeably
termed "onartuzumab"). In certain embodiments, the c-met antagonist is any one or
more of crizotinib, tivantinib, carbozantinib, MGCD-265, ficlatuzumab, humanized TAK-701,
rilotumumab, foretinib, h224G11, DN-30, MK-2461, E7050, MK-8033, PF-4217903, AMG208,
JNJ-38877605, EMD1204831, INC-280, LY-2801653, SGX-126, RP1040, LY2801653, BAY-853474,
and/or LA480. Other c-met antagonists suitable for use in the present inventions are
described herein.
[0034] Cancer medicaments can be used either alone or in combination with other cancer medicaments.
For example, in some embodiments, a c-met antagonist (e.g., anti-c-met antibody) is
used in combination with an EGFR antagonist (e.g., erlotinib). In certain embodiments,
erlotinib is administered at a dose of 150 mg, each day of a three week cycle. In
certain embodiments, erlotinib is administered at a dose of 100 mg, each day of a
three week cycle. In certain embodiments, erlotinib is administered at a dose of 50
mg, each day of a three week cycle. An exemplary protocol is administering to a NSCLC
patient (a) an anti-c-met antibody (such as MetMAb) at a dose of about 15 mg/kg every
three weeks; and (b) erlotinib (N-(3-ethynylphenyl)-6,7-bis(2-methoxyethoxy)-4-quinazolinamine)
at a dose of 150 mg, each day of a three week cycle. In other embodiments, a c-met
antagonist (e.g., anti-c-met antibody) is used in combination with an anti-VEGF antibody
and chemotherapy (e.g., a taxane). An exemplary protocol is administering to a triple-negative
metastatic breast cancer patient an anti-c-met antibody (e.g., MetMAb) administered
at a dose of 10 mg/kg on Day 1 and Day 15 of a 28-day cycle, anti-VEGF antibody (e.g.,
bevacizumab) administered at a dose of 10 mg/kg on Day 1 and Day 15 of the 28-day
cycle and paclitaxel administered at a dose of 90 mg/m
2 by IV infusion on Day 1, Day 8, and Day 15 of the 28-day cycle. Another exemplary
protocol is administering to a triple-negative metastatic breast cancer patient an
anti-c-met antibody (e.g., MetMAb) administered at a dose of 10 mg/kg on Day 1 and
Day 15 of a 28-day cycle, and paclitaxel administered at a dose of 90 mg/m
2 by IV infusion on Day 1, Day 8, and Day 15 of the 28-day cycle. In certain embodiments,
MetMAb is administered at a dose of about 15 mg/kg every three weeks, or at a dose
of about 10 mg/kg every two weeks. In some embodiments, crizotinib is used in combination
with an EGFR antagonist (in some embodiments, erlotinib). In some embodiments, carbozantinib
is used in combination with an EGFR antagonist (in some embodiments, erlotinib). In
some embodiments, foretinib is used in combination with an EGFR antagonist (in some
embodiments, erlotinib). In some embodiments, tivantinib is used in combination with
an EGFR antagonist (in some embodiments, erlotinib). In some embodiments, MGCD-265
is used in combination with an EGFR antagonist (in some embodiments, erlotinib). In
some embodiments, rilotumumab is used in combination with an EGFR antagonist (in some
embodiments, erlotinib). In some embodiments, ficlatuzumab is used in combination
with an EGFR antagonist (in some embodiments, erlotinib). In some embodiments, humanized
anti-HGF antibody TAK-701 is used in combination with an EGFR antagonist (in some
embodiments, erlotinib). Other cancer medicaments are described herein.
[0035] Detection of c-met biomarker is disclosed and exemplified herein. In some embodiments
of any of the inventions described herein, high expression of a c-met biomarker in
a patent's cancer is high protein expression and, in further embodiments, is determined
using IHC. In some embodiments, the IHC score is 2 or 3. In some embodiments, the
IHC score is 3. In some embodiments, the IHC score is 2. In some embodiments, high
c-met biomarker is (means) 50% or more tumor cells with moderate c-met staining intensity,
combined moderate/high c-met staining intensity or high c-met staining intensity.
In some embodiments, high-c-met biomarker is 50% or more of tumor cells with moderate
or high c-met staining intensity. In some embodiments, high expression of a c-met
biomarker is high mRNA expression (and in some embodiments, detected using qualitative
RT-PCR or in situ hybridization). In some embodiments, high expression of a c-met
biomarker is c-met gene amplification (and in some embodiments, detected using FISH).
In other embodiments, gene expression profiling, PCR (such as rtPCR), RNN-seq, microarray
analysis, SAGE, MassARRAY technique, or FISH is used to detect c-met biomarker. In
some embodiments, the PFS and/or OS is likely increased (i.e., there is a likelihood
of increased PFS and/or OS) relative to a patient who is not treated with the c-met
antagonist (or in some embodiments, treated with c-met antagonist in combination with
EGFR antagonist). In some embodiments of any of the inventions disclosed herein, high
c-met biomarker expression is met diagnostic positive clinical status as defined in
accordance with Table A herein.
[0036] In some embodiments of any of the inventions described herein, low expression of
a c-met biomarker in a patient's cancer is low protein expression and is determined
using IHC. In some embodiments, the IHC score is 1. In some embodiments, the IHC score
is 0. In some embodiments, the IHC score is 0 or 1. In some embodiments, low c-met
biomarker is negative c-met staining, less than 50% of tumor cells with weak or combined
weak and moderate c-met staining intensity, or 50% or more tumor cells with weak or
combined weak and moderate c-met staining intensity but less than 50% tumor cells
with moderate or combined moderate and strong c-met staining intensity. In some embodiments,
low c-met biomarker means increased likelihood of decreased PFS and OS when the patient
is treated with the c-met antagonist (or in some embodiments, treated with c-met antagonist
in combination with EGFR antagonist). In some embodiments, the PFS and/or OS is likely
decreased (i.e., there is a likelihood of decreased PFS and/or OS) relative to a patient
who is not treated with the c-met antagonist (or in some embodiments, treated with
c-met antagonist in combination with EGFR antagonist). In some embodiments of any
of the inventions disclosed herein, low c-met biomarker expression is met diagnostic
negative clinical status as defined in accordance with Table A herein.
[0037] Optionally, additional biomarkers may be detected in a patient's sample. In some
embodiments, the patient's cancer has been found to express wildtype EGFR (in some
embodiments, further expresses c-met gene amplification, and in still further embodiments,
does not express c-met gene amplification)..In certain embodiments, the patient's
cancer has been found to express a biomarker selected from kras and EGFR. In some
embodiments, the patient's cancer has been found to express mutated kras. In some
embodiments, the patient's cancer has been found to express wildtype kras. In some
embodiments, the patient's cancer has been found to express mutated EGFR. In some
embodiments, the patient's cancer (e.g., the patient's NSCLC) has been found to express
an anaplastic lymphoma kinase (ALK) translocation. In some embodiments, the ALK translocation
is an EML4-ALK translocation. In some embodiments, the patient's cancer has been found
to express mutated c-met. In some embodiments, the patient's cancer has been found
to express wildtype c-met.
[0038] Further embodiments regarding determination of biomarker (e.g. c-met biomarker) expression
are disclosed herein.
[0039] In another aspect, the invention provides a method for evaluating adverse events
in a patient associated with treatment of a cancer that expresses a high amount of
c-met biomarker, wherein treatment is with a c-met antagonist (e.g., )MetMAb (onartuzumab))
and the method comprises the steps of monitoring the number and/or severity of one
or more adverse events. Exemplary adverse events are disclosed herein.
BRIEF DESCRIPTION OF THE FIGURES
[0040] The patent or application file contains at least one drawing executed in color. Copies
of this patent or patent application publication with color drawing(s) will be provided
by the Office upon request and payment of the necessary fee.
Figure 1 shows exemplary IHC analysis of control cell pellets.
Figure 2 shows an example of IHC analysis of NSCLC tumor samples.
Figure 3 shows analysis of treatment of Met high patients with Erlotinib + placebo
(solid line) verses Erlotinib + MetMAb (dashed line).
Figure 4 shows analysis of treatment of Met low patients with Erlotinib + placebo
(solid line) verses Erlotinib + MetMAb (dashed line).
Figure 5 shows analysis of treatment of all patients with Erlotinib + placebo (solid
line) verses Erlotinib + MetMAb (dashed line),
Figure 6 shows PFS examined by subgroups.
Figure 7 shows OS examined by subgroups.
Figure 8 shows analysis of prognosis by Met expression in erlotinib + placebo treated
patients. Met low = dashed line; Met high = solid line.
Figure 9 shows subgroup analysis of PFS in Met High patients.
Figure 10 shows subgroup analysis of OS in Met High patients.
Figure 11 shows subgroup analysis of PFS in Met Low patients.
Figure 12 shows subgroup analysis of OS in Met Low patients.
Figure 13 shows final analysis of treatment of Met diagnostic positive patients with
Erlotinib + placebo (solid line) verses Erlotinib + MetMAb (dashed line).
Figure 14 shows final analysis of treatment of Met diagnostic negative patients with
Erlotinib + placebo (solid line) verses Erlotinib + MetMAb (dashed line).
Figure 15 shows final analysis of treatment of all patients with Erlotinib + placebo
(solid line) verses Erlotinib + MetMAb (dashed line).
Figure 16 shows OS examined by subgroups.
Figure 17 shows final analysis of OS in Met diagnostic negative patients
Figure 18 shows OS analysis on certain subpopulations of patients.
Figure 19 shows that Met expression was associated with worse outcome in Erlotinib
+ placebo treated patients.
Figure 20 shows the relationship of MET mRNA levels with met IHC clinical score.
Figure 21 shows the treatment effect of MetMAb in combination with erlotinib evaluated
in patients defined using less stringent Met expression cutoff and more stringent
Met expression cutoffs. All Hazard ratios were estimated from unstratified analyses.
DETAILED DESCRIPTION OF EMBODIMENTS OF THE INVENTION
I. DEFINITIONS
[0041] Herein, a "patient" is a human patient. The patient may be a "cancer patient,"
i.e. one who is suffering or at risk for suffering from one or more symptoms of cancer.
Moreover, the patient may be a previously treated cancer patient. The patient may
be a "NSCLC cancer patient,"
i. e. one who is suffering or at risk for suffering from one or more symptoms of NSCLC.
Moreover, the patient may be a previously treated NSCLC patient.
[0042] The term "c-met" or "Met", as used herein, refers, unless indicated otherwise, to
any native or variant (whether native or synthetic) c-met polypeptide. The term "wild
type c-met" generally refers to a polypeptide comprising the amino acid sequence of
a naturally occurring c-met protein. The term "wild type c-met sequence" generally
refers to an amino acid sequence found in a naturally occurring c-met.
[0043] An "anti-c-met antibody" is an antibody that binds to c-met with sufficient affinity
and specificity. The antibody selected will normally have a sufficiently strong binding
affinity for c-met, for example, the antibody may bind human c-met with a K
d value of between 100 nM-1 pM. Antibody affinities may be determined by a surface
plasmon resonance based assay (such as the BTAcore assay as described in
PCT Application Publication No. WO2005/012359); enzyme-linked immunoabsorbent assay (ELISA); and competition assays (e.g. RIA's),
for example. In certain embodiments, the anti-c-met antibody can be used as a therapeutic
agent in targeting and interfering with diseases or conditions wherein c-met activity
is involved. Also, the antibody may be subjected to other biological activity assays,
e.g., in order to evaluate its effectiveness as a therapeutic. Such assays are known
in the art and depend on the target antigen and intended use for the antibody.
[0044] A "c-met antagonist" (interchangeably termed "c-met inhibitor") is an agent that
interferes with c-met activation or function. Examples of c-met inhibitors include
c-met antibodies; HGF antibodies; small molecule c-met antagonists; c-met tyrosine
kinase inhibitors; antisense and inhibitory RNA (e.g., shRNA) molecules (see, for
example,
WO2004/87207). Preferably, the c-met inhibitor is an antibody or small molecule which binds to
c-met. In a particular embodiment, a c-met inhibitor has a binding affinity (dissociation
constant) to c-met of about 1,000 nM or less. In another embodiment, a c-met inhibitor
has a binding affinity to c-met of about 100 nM or less. In another embodiment, a
c-met inhibitor has a binding affinity to c-met of about 50 nM or less. In a particular
embodiment, a c-met inhibitor is covalently bound to c-met. In a particular embodiment,
a c-met inhibitor inhibits c-met signaling with an IC50 of 1,000 nM or less. In another
embodiment, a c-met inhibitor inhibits c-met signaling with an IC50 of 500 nM or less.
In another embodiment, a c-met inhibitor inhibits c-met signaling with an IC50 of
50 nM or less.
[0045] "C-met activation" refers to activation, or phosphorylation, of the c-met receptor.
Generally, c-met activation results in signal transduction (e.g. that caused by an
intracellular kinase domain of a c-met receptor phosphorylating tyrosine residues
in c-met or a substrate polypeptide). C-met activation may be mediated by c-met ligand
(HGF) binding to a c-met receptor of interest. HGF binding to c-met may activate a
kinase domain of c-met and thereby result in phosphorylation of tyrosine residues
in the c-met and/or phosphorylation of tyrosine residues in additional substrate polypeptides(s).
[0046] A "population" of subjects refers to a group of subjects with cancer, such as in
a clinical trial, or as seen by oncologists following FDA approval for a particular
indication, such as breast cancer therapy.
[0047] The phrase "does not possess substantial biomarker expression" or "substantially
no biomarker expression" with respect to a biomarker, as used herein, means the biomarker
does not exhibit an expression level that is above background level that is of statistical
significance. The phrase "little to no biomarker expression" with respect to a biomarker,
as used herein, means the biomarker does not display a biologically meaningful amount
of expression. As would be understood in the art, amount of expression may be determined
quantitatively or qualitatively, so long as a comparison between a biomarker sample
and a reference counterpart can be done. The expression can be measured or detected
according to any assay or technique known in the art, including, e.g., those described
herein (such as IHC).
[0048] The term "gene amplification" refers to a process by which multiple copies of a gene
or gene fragment are formed in a particular cell or cell line.
[0049] For the methods of the invention, the term "instructing" a patient means providing
directions for applicable therapy, medication, treatment, treatment regimens, and
the like, by any means, but preferably in writing, such as in the form of package
inserts or other written promotional material.
[0050] For the methods of the invention, the term "promoting" means offering, advertising,
selling, or describing a particular drug, combination of drugs, or treatment modality,
by any means, including writing, such as in the form of package inserts. Promoting
herein refers to promotion of therapeutic agent(s), such as an anti-c-met antibody
and/or erlotinib, for an indication, such as NSCLC treatment, where such promoting
is authorized by the Food and Drug Administration (FDA) as having been demonstrated
to be associated with statistically significant therapeutic efficacy and acceptable
safety in a population of subjects
[0051] The term "marketing" is used herein to describe the promotion, selling or distribution
of a product (e.g., drug). Marketing specifically includes packaging, advertising,
and any business activity with the purpose of commercializing a product.
[0052] For the purposes herein, a "previously treated" cancer patient has received prior
cancer therapy.
[0053] "Refractory" cancer progresses even though an anti-tumor agent, such as a chemotherapeutic
agent, is being administered to the cancer patient.
[0054] A "cancer medicament" is a drug effective for treating cancer. Examples of cancer
medicaments include the chemotherapeutic agents and chemotherapy regimens noted below;
c-met antagonists, including anti-c-met antibodies, such as MetMAb.
[0055] The term "biomarker" or "marker" as used herein refers generally to a molecule, including
a gene, mRNA, protein, carbohydrate structure, or glycolipid, the expression of which
in or on a tissue or cell or secreted can be detected by known methods (or methods
disclosed herein) and is predictive or can be used to predict (or aid prediction)
for a cell, tissue, or patient's responsiveness to treatment regimes. The biomarker
of particular interest herein is c-met. In some embodiments, the c-met biomarker does
not include amplification of c-met gene (e.g., an average in a population of cells
of 3 or more, 4 or more, or 5 or more copies of c-met gene, or more, such as an average
of 8 or more, or 10 or more copies of c-met gene).
[0056] By "patient sample" is meant a collection of similar cells obtained from a cancer
patient. The source of the tissue or cell sample may be solid tissue as from a fresh,
frozen and/or preserved organ or tissue sample or biopsy or aspirate; blood or any
blood constituents; bodily fluids such as cerebral spinal fluid, amniotic fluid, peritoneal
fluid, or interstitial fluid; cells from any time in gestation or development of the
subject. The tissue sample may contain compounds which are not naturally intermixed
with the tissue in nature such as preservatives, anticoagulants, buffers, fixatives,
nutrients, antibiotics, or the like. Examples of tumor samples herein include, but
are not limited to, tumor biopsies, circulating tumor cells, serum or plasma, circulating
plasma proteins, ascitic fluid, primary cell cultures or cell lines derived from tumors
or exhibiting tumor-like properties, as well as preserved tumor samples, such as formalin-fixed,
paraffin-embedded tumor samples or frozen tumor samples. In one embodiment the sample
comprises NSCLC (e.g., squamous subtype or nonsquamous subtype) tumor sample.
[0057] An "effective response" of a patient or a patient's "responsiveness" to treatment
with a medicament and similar wording refers to the clinical or therapeutic benefit
imparted to a patient at risk for, or suffering from, cancer (e.g., NSCLC) upon administration
of the cancer medicament. Such benefit includes any one or more of: extending survival
(including overall survival and progression free survival); resulting in an objective
response (including a complete response or a partial response); or improving signs
or symptoms of cancer, etc. In one embodiment, the biomarker (e.g., c-met expression,
for example, as determined using IHC) is used to identify the patient who is expected
to have greater progression free survival (PFS) when treated with a medicament (e.g.,
anti-c-met antibody), relative to a patient who does not express the biomarker at
the same level. In one embodiment, the biomarker is used to identify the patient who
is expected to have reduced PFS when treated with a medicament, relative to a patient
treated with the medicament who does not express the biomarker at the same level,
or relative to a patient who is not treated with the medicament who does not express
the biomarker at the same level. In one embodiment, the biomarker is used to identify
the patient who is expected to have greater overall survival (OS) when treated with
a medicament, relative to a patient who does not express the biomarker at the same
level. In one embodiment, the biomarker is used to identify the patient who is expected
to have reduced overall survival (OS), relative to a patient who is treated with the
medicament who does not express the biomarker at the same level, or relative to a
patient who is not treated with the medicament who does not express the biomarker
at the same level. The incidence of biomarker(s) herein effectively predicts, or predicts
with high sensitivity, such effective response.
[0058] "Survival" refers to the patient remaining alive, and includes overall survival as
well as progression free survival.
[0059] "Overall survival" refers to the patient remaining alive for a defined period of
time, such as 1 year, 5 years, etc from the time of diagnosis or treatment.
[0060] "Progression free survival" refers to the patient remaining alive, without the cancer
progressing or getting worse.
[0061] By "extending survival" is meant increasing overall or progression free survival
in a treated patient relative to an untreated patient (
i.
e. relative to a patient not treated with the medicament), or relative to a patient
who does not express a biomarker at the designated level, and/or relative to a patient
treated with an approved anti-tumor agent (such as chemotherapy regimen of erlotinib.
[0062] An "objective response" refers to a measurable response, including complete response
(CR) or partial response (PR).
[0063] By "complete response" or "CR" is intended the disappearance of all signs of cancer
in response to treatment. This does not always mean the cancer has been cured.
[0064] "Partial response" or "PR" refers to a decrease in the size of one or more tumors
or lesions, or in the extent of cancer in the body, in response to treatment.
[0065] The "amount" or "level" of a biomarker associated with an increased clinical benefit
to a cancer (e.g. NSCLC) patient refers to a detectable level in a biological sample
wherein the level of biomarker is associated with increased patient clinical benefit.
These can be measured by methods known to the expert skilled in the art and also disclosed
by this invention. The expression level or amount of biomarker assessed can be used
to determine the response to the treatment. In some embodiments, the amount or level
of biomarker is determined using IHC (e.g., of patient tumor sample). In some embodiments,
amount or level of a c-met biomarker associated with an increased clinical benefit
in a cancer patient is an IHC score of 2, an IHC score of 3, or an IHC score of 2
or 3. In some embodiments, amount or level of a c-met biomarker associated with an
increased clinical benefit in a cancer patient is 50% or more tumor cells with moderate
c-met staining intensity, combined moderate/high c-met staining intensity or high
c-met staining intensity. In some embodiments, amount or level of a c-met biomarker
associated with an increased clinical benefit in a cancer patient is 50% or more of
tumor cells with moderate or high c-met staining intensity.
[0066] The "amount" or "level" of a biomarker associated with a decreased clinical benefit
to a cancer (e.g. NSCLC) patient refers to lack of detectable biomarker or a low detectable
level in a biological sample, wherein the level of biomarker is associated with decreased
clinical benefit to the patient. These can be measured by methods known to the expert
skilled in the art and also disclosed by this invention. The expression level or amount
of biomarker assessed can be used to determine the response to the treatment. In some
embodiments, the amount or level of biomarker is determined using IHC (e.g., of patient
tumor sample). In some embodiments, amount or level of a c-met biomarker associated
with a decreased clinical benefit in a cancer patient is an IHC score of 0, an IHC
score of 1, or an IHC score of 0 or 1. In some embodiments, an amount or a level of
biomark associated with a decreased clinical benefit in a cancer patient is negative
c-met staining, less than 50% of tumor cells with weak or combined weak and moderate
c-met staining intensity, or 50% or more tumor cells with weak or combined weak and
moderate c-met staining intensity but less than 50% tumor cells with moderate or combined
moderate and strong c-met staining intensity.
[0067] The terms "level of expression" or "expression level" in general are used interchangeably
and generally refer to the amount of a polynucleotide, mRNA, or an amino acid product
or protein in a biological sample. "Expression" generally refers to the process by
which gene-encoded information is converted into the structures present and operating
in the cell. Therefore, according to the invention "expression" of a gene may refer
to transcription into a polynucleotide, translation into a protein, or even posttranslational
modification of the protein. Fragments of the transcribed polynucleotide, the translated
protein, or the post-translationally modified protein shall also be regarded as expressed
whether they originate from a transcript generated by alternative splicing or a degraded
transcript, or from a post-translational processing of the protein, e.g., by proteolysis.
In some embodiments, "level of expression" refers to amount of a protein in a biological
sample as determined using IHC.
[0068] The phrase "based on expression of" when used herein means that information about
expression level of the one or more biomarkers herein is used to inform a treatment
decision, information provided on a package insert, or marketing/promotional guidance
etc. In the case of high expression of the biomarker, patients may be treated with
a cancer (e.g. NSCLC) medicament such as a c-met antagonist (e.g., anti-c-met antibody,
e.g., MetMAb). In the case of reduced level of expression of the biomarker, patients
may be treated with a cancer medicament other than c-met antagonist (e.g., anti-c-met
antibody, e.g. MetMAb).
[0069] "Treatment" refers to both therapeutic treatment and prophylactic or preventative
measures. Those in need of treatment include those already having a benign, pre-cancerous,
or non-metastatic tumor as well as those in which the occurrence or recurrence of
cancer is to be prevented.
[0070] The term "therapeutically effective amount" refers to an amount of a therapeutic
agent to treat or prevent a disease or disorder in a mammal. In the case of cancers,
the therapeutically effective amount of the therapeutic agent may reduce the number
of cancer cells; reduce the primary tumor size; inhibit (i.e., slow to some extent
and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e.,
slow to some extent and preferably stop) tumor metastasis; inhibit, to some extent,
tumor growth; and/or relieve to some extent one or more of the symptoms associated
with the disorder. To the extent the drug may prevent growth and/or kill existing
cancer cells, it may be cytostatic and/or cytotoxic. For cancer therapy, efficacy
in vivo can, for example, be measured by assessing the duration of survival, time
to disease progression (TTP), the response rates (RR), duration of response, and/or
quality of life. The terms "cancer" and "cancerous" refer to or describe the physiological
condition in mammals that is typically characterized by unregulated cell growth. Included
in this definition are benign and malignant cancers. By "early stage cancer" or "early
stage tumor" is meant a cancer that is not invasive or metastatic or is classified
as a Stage 0, I, or II cancer. Examples of cancer include, but are not limited to,
carcinoma, lymphoma, blastoma (including medulloblastoma and retinoblastoma), sarcoma
(including liposarcoma and synovial cell sarcoma), neuroendocrine tumors (including
carcinoid tumors, gastrinoma, and islet cell cancer), mesothelioma, schwannoma (including
acoustic neuroma), meningioma, adenocarcinoma, melanoma, and leukemia or lymphoid
malignancies. More particular examples of such cancers include squamous cell cancer
(e.g. epithelial squamous cell cancer), lung cancer including small-cell lung cancer
(SCLC), non-small cell lung cancer (NSCLC), adenocarcinoma of the lung and squamous
carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or
stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma,
cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer
(including metastatic breast cancer), colon cancer, rectal cancer, colorectal cancer,
endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer,
prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma,
penile carcinoma, testicular cancer, esophageal cancer, tumors of the biliary tract,
as well as head and neck cancer. In some embodiments, the cancer is triple-negative
metastatic breast cancer, including any histologically confirmed triple-negative (ER-,
PR-, HER2-) adenocarcinoma of the breast with locally recurrent or metastatic disease
(where the locally recurrent disease is not amenable to resection with curative intent).
[0071] A cancer or biological sample which "displays c-met expression" is one which, in
a diagnostic test, expresses (including overexpresses) a c-met receptor.
[0072] A cancer or biological sample which "displays c-met amplification" is one which,
in a diagnostic test, has amplified c-met gene. In some embodiments, amplified c-met
gene is an average (in a population of cell) of greater than or equal to 5 or more
copies of the c-met gene, or an average of eight or more copies of a c-met gene, or
more.
[0073] A cancer or biological sample which "does not display c-met amplification" is one
which, in a diagnostic test, does not have amplified c-met gene. In some embodiments,
a sample which does not display c-met amplification is a sample which has an average
of fewer than 4 copies of c-met gene.
[0074] By "EGFR" is meant the receptor tyrosine kinase polypeptide Epidermal Growth Factor
Receptor which is described in
Ullrich et al, Nature (1984) 309:418425, alternatively referred to as Her-1 and the c-erbB gene product, as well as variants
thereof such as EGFRvIII. Variants of EGFR also include deletional, substitutional
and insertional variants, for example those described in
Lynch et al (New England Journal of Medicine 2004, 350:2129),
Paez et al (Science 2004, 304:1497),
Pao et al (PNAS 2004, 101:13306).
[0075] An "EGFR antagonist" (interchangeably termed "EGFR inhibitor") is an agent that interferes
with EGFR activation or function. Examples of EGFR inhibitors include EGFR antibodies;
EGFR ligand antibodies; small molecule EGFR antagonists; EGFR tyrosine kinase inhibitors;
antisense and inhibitory RNA (e.g., shRNA) molecules (see, for example,
WO2004/87207). Preferably, the EGFR inhibitor is an antibody or small molecule which binds to
EGFR. In some embodiments, the EGFR inhibitor is an EGFR-targeted drug. In a particular
embodiment, an EGFR inhibitor has a binding affinity (dissociation constant) to EGFR
of about 1,000 nM or less. In another embodiment, an EGFR inhibitor has a binding
affinity to EGFR of about 100 nM or less. In another embodiment, an EGFR inhibitor
has a binding affinity to EGFR of about 50 nM or less. In a particular embodiment,
an EGFR inhibitor is covalently bound to EGFR. In a particular embodiment, an EGFR
inhibitor inhibits EGFR signaling with an IC50 of 1,000 nM or less. In another embodiment,
an EGFR inhibitor inhibits EGFR signaling with an IC50 of 500 nM or less. In another
embodiment, an EGFR inhibitor inhibits EGFR signaling with an IC50 of 50 nM or less.
In certain embodiments, the EGFR antagonist reduces or inhibits, by at least 10%,
20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more, the expression level or biological
activity of EGFR.
[0076] "EGFR activation" refers to activation, or phosphorylation, of EGFR. Generally, EGFR
activation results in signal transduction (e.g. that caused by an intracellular kinase
domain of EGFR receptor phosphorylating tyrosine residues in EGFR or a substrate polypeptide).
EGFR activation may be mediated by EGFR ligand binding to a EGFR dimer comprising
EGFR. EGFR ligand binding to a EGFR dimer may activate a kinase domain of one or more
of the EGFR in the dimer and thereby results in phosphorylation of tyrosine residues
in one or more of the EGFR and/or phosphorylation of tyrosine residues in additional
substrate polypeptides(s).
[0077] As used herein, the term "EGFR-targeted drug" refers to a therapeutic agent that
binds to EGFR and inhibits EGFR activation. Examples of such agents include antibodies
and small molecules that bind to EGFR. Examples of antibodies which bind to EGFR include
MAb 579 (ATCC CRL HB 8506), MAb 455 (ATCC CRL HB8507), MAb 225 (ATCC CRL 8508), MAb
528 (ATCC CRL 8509) (see,
US Patent No. 4,943, 533, Mendelsohn et al.) and variants thereof, such as chimerized 225 (C225 or Cetuximab; ERBUTIX®) and reshaped
human 225 (H225) (see,
WO 96/40210, Imclone Systems Inc.); IMC-11F8, a fully human, EGFR-targeted antibody (Imclone);
antibodies that bind type II mutant EGFR (
US Patent No. 5,212,290); humanized and chimeric antibodies that bind EGFR as described in
US Patent No. 5,891,996; and human antibodies that bind EGFR, such as ABX-EGF (see
WO98/50433, Abgenix); EMD 55900 (
Stragliotto et al. Eur. J. Cancer 32A:636-640 (1996)); EMD7200 (matuzumab) a humanized EGFR antibody directed against EGFR that competes
with both EGF and TGF-alpha for EGFR binding; and mAb 806 or humanized mAb 806 (
Johns et al., J. Biol. Chem. 279(29):30375-30384 (2004)). The anti-EGFR antibody may be conjugated with a cytotoxic agent, thus generating
an immunoconjugate (see,
e.g., EP659,439A2, Merck Patent GmbH). Examples of small molecules that bind to EGFR include ZD1839
or Gefitinib (TRESSA; Astra Zeneca); CP-358774 or Erlotinib (TARCEVA™; Genentech/OSI);
and AG1478, AG1571 (SU 5271; Sugen); EMD-7200.
[0078] The technique of "polymerase chain reaction" or "PCR" as used herein generally refers
to a procedure wherein minute amounts of a specific piece of nucleic acid, RNA and/or
DNA, are amplified as described in
U.S. Pat. No. 4,683,195 issued 28 July 1987. Generally, sequence information from the ends of the region of interest or beyond
needs to be available, such that oligonucleotide primers can be designed; these primers
will be identical or similar in sequence to opposite strands of the template to be
amplified. The 5' terminal nucleotides of the two primers may coincide with the ends
of the amplified material. PCR can be used to amplify specific RNA sequences, specific
DNA sequences from total genomic DNA, and cDNA transcribed from total cellular RNA,
bacteriophage or plasmid sequences, etc. See generally
Mullis et al., Cold Spring Harbor Symp. Quant. Biol., 51: 263 (1987);
Erlich, ed., PCR Technology, (Stockton Press, NY, 1989). As used herein, PCR is considered to be one, but not the only, example of a nucleic
acid polymerase reaction method for amplifying a nucleic acid test sample, comprising
the use of a known nucleic acid (DNA or RNA) as a primer and utilizes a nucleic acid
polymerase to amplify or generate a specific piece of nucleic acid or to amplify or
generate a specific piece of nucleic acid which is complementary to a particular nucleic
acid.
[0080] The term "microarray" refers to an ordered arrangement of hybridizable array elements,
preferably polynucleotide probes, on a substrate.
[0081] The term "polynucleotide," when used in singular or plural, generally refers to any
polyribonucleotide or polydeoxyribonucleotide, which may be unmodified RNA or DNA
or modified RNA or DNA. Thus, for instance, polynucleotides as defined herein include,
without limitation, single- and double-stranded DNA, DNA including single- and double-stranded
regions, single- and double-stranded RNA, and RNA including single- and double-stranded
regions, hybrid molecules comprising DNA and RNA that may be single-stranded or, more
typically, double-stranded or include single- and double-stranded regions. In addition,
the term "polynucleotide" as used herein refers to triple- stranded regions comprising
RNA or DNA or both RNA and DNA. The strands in such regions may be from the same molecule
or from different molecules. The regions may include all of one or more of the molecules,
but more typically involve only a region of some of the molecules. One of the molecules
of a triple-helical region often is an oligonucleotide. The term "polynucleotide"
specifically includes cDNAs. The term includes DNAs (including cDNAs) and RNAs that
contain one or more modified bases. Thus, DNAs or RNAs with backbones modified for
stability or for other reasons are "polynucleotides" as that term is intended herein.
Moreover, DNAs or RNAs comprising unusual bases, such as inosine, or modified bases,
such as tritiated bases, are included within the term "polynucleotides" as defined
herein. In general, the term "polynucleotide" embraces all chemically, enzymatically
and/or metabolically modified forms of unmodified polynucleotides, as well as the
chemical forms of DNA and RNA characteristic of viruses and cells, including simple
and complex cells.
[0082] The term "oligonucleotide" refers to a relatively short polynucleotide, including,
without limitation, single-stranded deoxyribonucleotides, single- or double-stranded
ribonucleotides, RNA:DNA hybrids and double- stranded DNAs. Oligonucleotides, such
as single- stranded DNA probe oligonucleotides, are often synthesized by chemical
methods, for example using automated oligonucleotide synthesizers that are commercially
available. However, oligonucleotides can be made by a variety of other methods, including
in vitro recombinant DNA-mediated techniques and by expression of DNAs in cells and
organisms.
[0083] A "chemotherapeutic agent" is a chemical compound useful in the treatment of cancer.
Examples of chemotherapeutic agents include alkylating agents such as thiotepa and
cyclosphosphamide (CYTOXAN®); alkyl sulfonates such as busulfan, improsulfan and piposulfan;
aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and
methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide,
triethiylenethiophosphoramide and trimethylolomelamine; acetogenins (especially bullatacin
and bullatacinone); delta-9-tetrahydrocannabinol (dronabinol, MARINOL®); beta-lapachone;
lapachol; colchicines; betulinic acid; a camptothecin (including the synthetic analogue
topotecan (HYCAMTIN®), CPT-11 (irinotecan, CAMPTOSAR®), acetylcamptothecin, scopolectin,
and 9-aminocamptothecin); bryostatin; callystatin; CC-1065 (including its adozelesin,
carzelesin and bizelesin synthetic analogues); podophyllotoxin; podophyllinic acid;
teniposide; cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin;
duocarmycin (including the synthetic analogues, KW-2189 and CB1-TM1); eleutherobin;
pancratistatin; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil,
chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine
oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide,
uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine,
nimustine, and ranimnustine; antibiotics such as the enediyne antibiotics (
e. g., calicheamicin, especially calicheamicin gamma1I and calicheamicin omegaI1 (see,
e.g., Nicolaou et al., Angew. Chem Intl. Ed. Engl., 33: 183-186 (1994)); CDP323, an oral alpha-4 integrin inhibitor; dynemicin, including dynemicin A;
an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein
enediyne antiobiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine,
bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin,
daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin (including ADRIAMYCIN®,
morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin, doxorubicin
HCl liposome injection (DOXIL®), liposomal doxorubicin TLC D-99 (MYOCET®), peglylated
liposomal doxorubicin (CAELYX®), and deoxydoxorubicin), epirubicin, esorubicin, idarubicin,
marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins,
peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin,
tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate,
gemcitabine (GEMZAR®), tegafur (UFTORAL®), capecitabine (XELODA®), an epothilone,
and 5-fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate,
pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine,
thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur,
cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; anti-adrenals
such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic
acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine;
bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elfornithine;
elliptinium acetate; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine;
maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol;
nitraerine; pentostatin; phenamet; pirarubicin; losoxantrone; 2-ethylhydrazide; procarbazine;
PSK® polysaccharide complex (JHS Natural Products, Eugene, OR); razoxane; rhizoxin;
sizofiran; spirogermanium; tenuazonic acid; triaziquone; 2,2',2"-trichlorotriethylamine;
trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine); urethan;
dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside
("Ara-C"); thiotepa; taxoid, e.g., paclitaxel (TAXOL®), albumin-engineered nanoparticle
formulation of paclitaxel (ABRAXANE™), and docetaxel (TAXOTERE®); chloranbucil; 6-thioguanine;
mercaptopurine; methotrexate; platinum agents such as cisplatin, oxaliplatin, and
carboplatin; vincas, which prevent tubulin polymerization from forming microtubules,
including vinblastine (VELBAN®), vincristine (ONCOVIN®), vindesine (ELDISINE®, FILDESIN®),
and vinorelbine (NAVELBINE®); etoposide (VP-16); ifosfamide; mitoxantrone; leucovovin;
novantrone; edatrexate; daunomycin; aminopterin; ibandronate; topoisomerase inhibitor
RFS 2000; difluorometlhylornithine (DMFO); retinoids such as retinoic acid, including
bexarotene (TARGRETIN®); bisphosphonates such as clodronate (for example, BONEFOS®
or OSTAC®), etidronate (DIDROCAL®), NE-58095, zoledronic acid/zoledronate (ZOMETA®),
alendronate (FOSAMAX®), pamidronate (AREDIA®), tiludronate (SKELID®), or risedronate
(ACTONEL®); troxacitabine (a 1,3-dioxolane nucleoside cytosine analog); antisense
oligonucleotides, particularly those that inhibit expression of genes in signaling
pathways implicated in aberrant cell proliferation, such as, for example, PKC-alpha,
Raf, H-Ras, and epidermal growth factor receptor (EGF-R); vaccines such as THERATOPE®
vaccine and gene therapy vaccines, for example, ALLOVECTIN® vaccine, LEUVECTIN® vaccine,
and VAXID® vaccine; topoisomerase 1 inhibitor (
e.g., LURTOTECAN®); rmRH (
e.g., ABARELIX®); BAY439006 (sorafenib; Bayer); SU-11248 (Pfizer); perifosine, COX-2 inhibitor
(e.g. celecoxib or etoricoxib), proteosome inhibitor (e.g. PS341); bortezomib (VELCADE®);
CCI-779; tipifarnib (R11577); orafenib, ABT510; Bcl-2 inhibitor such as oblimersen
sodium (GENASENSE®); pixantrone; EGFR inhibitors (see definition below); tyrosine
kinase inhibitors (see definition below); and pharmaceutically acceptable salts, acids
or derivatives of any of the above; as well as combinations of two or more of the
above such as CHOP, an abbreviation for a combined therapy of cyclophosphamide, doxorubicin,
vincristine, and prednisolone, and FOLFOX, an abbreviation for a treatment regimen
with oxaliplatin (ELOXATIN™) combined with 5-FU and leucovovin.
[0084] Herein, chemotherapeutic agents include "anti-hormonal agents" or "endocrine therapeutics"
which act to regulate, reduce, block, or inhibit the effects of hormones that can
promote the growth of cancer. They may be hormones themselves, including, but not
limited to: anti-estrogens with mixed agonist/antagonist profile, including, tamoxifen
(NOLVADEX®), 4-hydroxytamoxifen, toremifene (FARESTON®), idoxifene, droloxifene, raloxifene
(EVISTA®), trioxifene, keoxifene, and selective estrogen receptor modulators (SERMs)
such as SERM3; pure anti-estrogens without agonist properties, such as fulvestrant
(FASLODEX®), and EM800 (such agents may block estrogen receptor (ER) dimerization,
inhibit DNA binding, increase ER turnover, and/or suppress ER levels); aromatase inhibitors,
including steroidal aromatase inhibitors such as formestane and exemestane (AROMASIN®),
and nonsteroidal aromatase inhibitors such as anastrazole (ARIMIDEX®), letrozole (FEMARA®)
and aminoglutethimide, and other aromatase inhibitors include vorozole (RIVISOR®),
megestrol acetate (MEGASE®), fadrozole, and 4(5)-imidazoles; lutenizing hormone-releaseing
hormone agonists, including leuprolide (LUPRON® and ELIGARD®), goserelin, buserelin,
and tripterelin; sex steroids, including progestines such as megestrol acetate and
medroxyprogesterone acetate, estrogens such as diethylstilbestrol and premarin, and
androgens/retinoids such as fluoxymesterone, all transretionic acid and fenretinide;
onapristone; anti-progesterones; estrogen receptor down-regulators (ERDs); anti-androgens
such as flutamide, nilutamide and bicalutamide; and pharmaceutically acceptable salts,
acids or derivatives of any of the above; as well as combinations of two or more of
the above.
[0085] Specific examples of chemotherapeutic agents or chemotherapy regimens herein include:
alkylating agents (e.g. chlorambucil, bendamustine, or cyclophosphamide); nucleoside
analogues or antimetabolites (e.g. fludarabine), fludarabine and cyclophosphamide
(FC); prednisone or prednisolone; akylator-containing combination therapy, including
cyclophosphamide, vincristine, prednisolone (CHOP), or cyclophosphamide, vincristine,
prednisolone (CVP), etc.
[0086] A "target audience" is a group of people or an institution to whom or to which a
particular medicament is being promoted or intended to be promoted, as by marketing
or advertising, especially for particular uses, treatments, or indications, such as
individual patients, patient populations, readers of newspapers, medical literature,
and magazines, television or internet viewers, radio or internet listeners, physicians,
drug companies,
etc.
[0087] A "package insert" is used to refer to instructions customarily included in commercial
packages of therapeutic products, that contain information about the indications,
usage, dosage, administration, contraindications, other therapeutic products to be
combined with the packaged product, and/or warnings concerning the use of such therapeutic
products,
etc.
[0088] The term "antibody" herein is used in the broadest sense and encompasses various
antibody structures, including but not limited to monoclonal antibodies, polyclonal
antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments
so long as they exhibit the desired antigen-binding activity.
[0089] An "antibody fragment" refers to a molecule other than an intact antibody that comprises
a portion of an intact antibody that binds the antigen to which the intact antibody
binds. Examples of antibody fragments include but are not limited to Fv, Fab, Fab',
Fab'-SH, F(ab')
2; diabodies; linear antibodies; single-chain antibody molecules (e.g. scFv); and multispecific
antibodies formed from antibody fragments.
[0090] An "affinity matured" antibody refers to an antibody with one or more alterations
in one or more hypervariable regions (HVRs), compared to a parent antibody which does
not possess such alterations, such alterations resulting in an improvement in the
affinity of the antibody for antigen.
[0091] An "antibody that binds to the same epitope" as a reference antibody refers to an
antibody that blocks binding of the reference antibody to its antigen in a competition
assay by 50% or more, and conversely, the reference antibody blocks binding of the
antibody to its antigen in a competition assay by 50% or more.
[0092] The term "chimeric" antibody refers to an antibody in which a portion of the heavy
and/or light chain is derived from a particular source or species, while the remainder
of the heavy and/or light chain is derived from a different source or species.
[0093] The "class" of an antibody refers to the type of constant domain or constant region
possessed by its heavy chain. There are five major classes of antibodies: IgA, IgD,
IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes),
e.g., IgG
1, IgG
2, IgG
3, IgG
4, IgA
1, and IgA
2. The heavy chain constant domains that correspond to the different classes of immunoglobulins
are called α, δ, ε, γ, and µ, respectively.
[0094] The term "cytotoxic agent" as used herein refers to a substance that inhibits or
prevents a cellular function and/or causes cell death or destruction. Cytotoxic agents
include, but are not limited to, radioactive isotopes (e.g., At
211, I
131, I
125, Y
90, Re
186, Re
188, Sm
153, Bi
212, P
32, Pb
212 and radioactive isotopes of Lu); chemotherapeutic agents or drugs (e.g., methotrexate,
adriamicin, vinca alkaloids (vincristine, vinblastine, etoposide), doxorubicin, melphalan,
mitomycin C, chlorambucil, daunorubicin or other intercalating agents); growth inhibitory
agents; enzymes and fragments thereof such as nucleolytic enzymes; antibiotics; toxins
such as small molecule toxins or enzymatically active toxins of bacterial, fungal,
plant or animal origin, including fragments and/or variants thereof; and the various
antitumor or anticancer agents disclosed below.
[0095] "Effector functions" refer to those biological activities attributable to the Fc
region of an antibody, which vary with the antibody isotype. Examples of antibody
effector functions include: C1q binding and complement dependent cytotoxicity (CDC);
Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis;
down regulation of cell surface receptors (e.g. B cell receptor); and B cell activation.
[0096] The term "Fc region" herein is used to define a C-terminal region of an immunoglobulin
heavy chain that contains at least a portion of the constant region. The term includes
native sequence Fc regions and variant Fc regions. In one embodiment, a human IgG
heavy chain Fc region extends from Cys226, or from Pro230, to the carboxyl-terminus
of the heavy chain. However, the C-terminal lysine (Lys447) of the Fc region may or
may not be present. Unless otherwise specified herein, numbering of amino acid residues
in the Fc region or constant region is according to the EU numbering system, also
called the EU index, as described in
Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health
Service, National Institutes of Health, Bethesda, MD, 1991.
[0097] "Framework" or "FR" refers to variable domain residues other than hypervariable region
(HVR) residues. The FR of a variable domain generally consists of four FR domains:
FR1, FR2, FR3, and FR4. Accordingly, the HVR and FR sequences generally appear in
the following sequence in VH (or VL): FR1-H1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4.
[0098] The terms "full length antibody," "intact antibody," and "whole antibody" are used
herein interchangeably to refer to an antibody having a structure substantially similar
to a native antibody structure or having heavy chains that contain an Fc region as
defined herein.
[0099] A "human antibody" is one which possesses an amino acid sequence which corresponds
to that of an antibody produced by a human or a human cell or derived from a non-human
source that utilizes human antibody repertoires or other human antibody-encoding sequences.
This definition of a human antibody specifically excludes a humanized antibody comprising
non-human antigen-binding residues.
[0100] A "humanized" antibody refers to a chimeric antibody comprising amino acid residues
from non-human HVRs and amino acid residues from human FRs. In certain embodiments,
a humanized antibody will comprise substantially all of at least one, and typically
two, variable domains, in which all or substantially all of the HVRs (e.g., CDRs)
correspond to those of a non-human antibody, and all or substantially all of the FRs
correspond to those of a human antibody. A humanized antibody optionally may comprise
at least a portion of an antibody constant region derived from a human antibody. A
"humanized form" of an antibody, e.g., a non-human antibody, refers to an antibody
that has undergone humanization.
[0101] The term "hypervariable region" or "HVR," as used herein, refers to each of the regions
of an antibody variable domain which are hypervariable in sequence and/or form structurally
defined loops ("hypervariable loops"). Generally, native four-chain antibodies comprise
six HVRs; three in the VH (HI, H2, H3), and three in the VL (L1, L2, L3). HVRs generally
comprise amino acid residues from the hypervariable loops and/or from the "complementarity
determining regions" (CDRs), the latter being of highest sequence variability and/or
involved in antigen recognition. Exemplary hypervariable loops occur at amino acid
residues 26-32 (L1), 50-52 (L2), 91-96 (L3), 26-32 (H1), 53-55 (H2), and 96-101 (H3).
(
Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)). Exemplary CDRs (CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, and CDR-H3) occur at amino
acid residues 24-34 of L1, 50-56 of L2, 89-97 of L3, 31-35B of H1, 50-65 of H2, and
95-102 of H3. (
Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health
Service, National Institutes of Health, Bethesda, MD (1991)) With the exception of CDR1 in VH, CDRs generally comprise the amino acid residues
that form the hypervariable loops. CDRs also comprise "specificity determining residues,"
or "SDRs," which are residues that contact antigen. SDRs are contained within regions
of the CDRs called abbreviated-CDRs, or a-CDRs. Exemplary a-CDRs (a-CDR-L1, a-CDR-L2,
a-CDR-L3, a-CDR-H1, a-CDR-H2, and a-CDR-H3) occur at amino acid residues 31-34 of
L1, 50-55 of L2, 89-96 of L3, 31-35B of H1, 50-58 of H2, and 95-102 of H3. (See
Almagro and Fransson, Front. Biosci. 13:1619-1633 (2008)). Unless otherwise indicated, HVR residues and other residues in the variable domain
(e.g., FR residues) are numbered herein according to Kabat et al.,
supra. In one embodiment, the c-met antibody herein comprises the HVRs of SEQ ID NOs: 1-6.
[0102] An "immunoconjugate" is an antibody conjugated to one or more heterologous molecule(s),
including but not limited to a cytotoxic agent.
[0103] The term "monoclonal antibody" as used herein refers to an antibody obtained from
a population of substantially homogeneous antibodies, i.e., the individual antibodies
comprising the population are identical and/or bind the same epitope, except for possible
variant antibodies, e.g., containing naturally occurring mutations or arising during
production of a monoclonal antibody preparation, such variants generally being present
in minor amounts. In contrast to polyclonal antibody preparations, which typically
include different antibodies directed against different determinants (epitopes), each
monoclonal antibody of a monoclonal antibody preparation is directed against a single
determinant on an antigen. Thus, the modifier "monoclonal" indicates the character
of the antibody as being obtained from a substantially homogeneous population of antibodies,
and is not to be construed as requiring production of the antibody by any particular
method. For example, the monoclonal antibodies to be used in accordance with the present
invention may be made by a variety of techniques, including but not limited to the
hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing
transgenic animals containing all or part of the human immunoglobulin loci, such methods
and other exemplary methods for making monoclonal antibodies being described herein.
[0104] A "naked antibody" refers to an antibody that is not conjugated to a heterologous
moiety (e.g., a cytotoxic moiety) or radiolabel. The naked antibody may be present
in a pharmaceutical formulation.
[0105] "Native antibodies" refer to naturally occurring immunoglobulin molecules with varying
structures. For example, native IgG antibodies are heterotetrameric glycoproteins
of about 150,000 daltons, composed of two identical light chains and two identical
heavy chains that are disulfide-bonded. From N- to C-terminus, each heavy chain has
a variable region (VH), also called a variable heavy domain or a heavy chain variable
domain, followed by three constant domains (CH1, CH2, and CH3). Similarly, from N-
to C-terminus, each light chain has a variable region (VL), also called a variable
light domain or a light chain variable domain, followed by a constant light (CL) domain.
The light chain of an antibody may be assigned to one of two types, called kappa (κ)
and lambda (λ), based on the amino acid sequence of its constant domain.
[0106] The term "pharmaceutical formulation" refers to a sterile preparation that is in
such form as to permit the biological activity of the medicament to be effective,
and which contains no additional components that are unacceptably toxic to a subject
to which the formulation would be administered.
[0107] A "sterile" formulation is aseptic or free from all living microorganisms and their
spores.
[0108] A "kit" is any manufacture (e.g a package or container) comprising at least one reagent,
e.g., a medicament for treatment of cancer (e.g., NCSLC or triple-negative breast cancer),
or a reagent (e.g., antibody) for specifically detecting a biomarker gene or protein
of the invention. The manufacture is preferably promoted, distributed, or sold as
a unit for performing the methods of the present invention.
[0109] A "pharmaceutically acceptable carrier" refers to an ingredient in a pharmaceutical
formulation, other than an active ingredient, which is nontoxic to a subject. A pharmaceutically
acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer,
or preservative.
[0110] "Percent (%) amino acid sequence identity" with respect to a reference polypeptide
sequence is defined as the percentage of amino acid residues in a candidate sequence
that are identical with the amino acid residues in the reference polypeptide sequence,
after aligning the sequences and introducing gaps, if necessary, to achieve the maximum
percent sequence identity, and not considering any conservative substitutions as part
of the sequence identity. Alignment for purposes of determining percent amino acid
sequence identity can be achieved in various ways that are within the skill in the
art, for instance, using publicly available computer software such as BLAST, BLAST-2,
ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate
parameters for aligning sequences, including any algorithms needed to achieve maximal
alignment over the full length of the sequences being compared. For purposes herein,
however, % amino acid sequence identity values are generated using the sequence comparison
computer program ALIGN-2. The ALIGN-2 sequence comparison computer program was authored
by Genentech, Inc., and the source code has been filed with user documentation in
the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S.
Copyright Registration No. TXU510087. The ALIGN-2 program is publicly available from
Genentech, Inc., South San Francisco, California, or may be compiled from the source
code. The ALIGN-2 program should be compiled for use on a UNIX operating system, including
digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program
and do not vary.
[0111] In situations where ALIGN-2 is employed for amino acid sequence comparisons, the
% amino acid sequence identity of a given amino acid sequence A to, with, or against
a given amino acid sequence B (which can alternatively be phrased as a given amino
acid sequence A that has or comprises a certain % amino acid sequence identity to,
with, or against a given amino acid sequence B) is calculated as follows:

where X is the number of amino acid residues scored as identical matches by the sequence
alignment program ALIGN-2 in that program's alignment of A and B, and where Y is the
total number of amino acid residues in B. It will be appreciated that where the length
of amino acid sequence A is not equal to the length of amino acid sequence B, the
% amino acid sequence identity of A to B will not equal the % amino acid sequence
identity of B to A. Unless specifically stated otherwise, all % amino acid sequence
identity values used herein are obtained as described in the immediately preceding
paragraph using the ALIGN-2 computer program.
II. CANCER MEDICAMENTS
[0112] In one aspect, the invention concerns selecting patients who can be treated with
cancer medicaments based on expression of one or more of the biomarkers disclosed
herein. Examples of cancer medicaments include, but are not limited to:
- c-met antagonists, including anti-c-met antibodies.
- Chemotherapeutic agents and chemotherapy regimens.
- Other medicaments or combinations thereof in development, or approved, for treating
cancer, e.g., NSCLC.
[0113] In one embodiment, the medicament is an antibody, e.g. directed against or which
binds to c-met. The antibody herein includes: monoclonal antibodies, including a chimeric,
humanized or human antibodies. In one embodiment, the antibody is an antibody fragment,
e.g., a Fv, Fab, Fab', one-armed antibody, scFv, diabody, or F(ab')
2 fragment. In another embodiment, the antibody is a full length antibody, e.g., an
intact IgG1 antibody or other antibody class or isotype as defined herein. In one
embodiment, the antibody is monovalent. In another embodiment, the antibody is a one-armed
antibody (i.e., the heavy chain variable domain and the light chain variable domain
form a single antigen binding arm) comprising an Fc region, wherein the Fc region
comprises a first and a second Fc polypeptide, wherein the first and second Fc polypeptides
are present in a complex and form a Fc region that increases stability of said antibody
fragment compared to a Fab molecule comprising said antigen binding arm. The one-armed
antibody may be monovalent.
[0114] In one embodiment, the c-met antagonist is an anti-c-met antibody. In another embodiment,
the anti-c-met antibody is MetMAb (onartuzumab) or a biosimilar version thereof. MetMAb
is disclosed in, for example,
WO2006/015371;
Jin et al, Cancer Res (2008) 68:4360. In another embodiment, the anti-c-met antibody comprises a heavy chain variable
domain comprising one or more of (a) HVR1 comprising sequence GYTFTSYWLH (SEQ ID NO:1);
(b) HVR2 comprising sequence GMIDPSNSDTRFNPNFKD (SEQ ID NO: 2); and/or (c) HVR3-HC
comprising sequence ATYRSYVTPLDY (SEQ ID NO: 3). In some embodiments, the antibody
comprises a light chain variable domain comprising one or more of (a) HVR1-LC comprising
sequence KSSQSLLYTSSQKNYLA (SEQ ID NO: 4); HVR2-LC comprising sequence WASTRES (SEQ
ID NO: 5); and/or (c) HVR3-LC comprising sequence QQYYAYPWT (SEQ ID NO: 6). In some
embodiments the anti-c-met antibody comprises a heavy chain variable domain comprising
(a) HVR1 comprising sequence GYTFTSYWLH (SEQ ID NO: 1); (b) HVR2 comprising sequence
GMIDPSNSDTRFNPNFKD (SEQ ID NO: 2); and (c) HVR3-HC comprising sequence ATYRSYVTPLDY
(SEQ ID NO: 3) and a light chain variable domain comprising (a) HVR1-LC comprising
sequence KSSQSLLYTSSQKNYLA (SEQ ID NO: 4); HVR2-LC comprising sequence WASTRES (SEQ
ID NO: 5); and (c) HVR3-LC comprising sequence QQYYAYPWT (SEQ ID NO: 6).
[0115] In any of the above embodiments, for example, an anti-c-met antibody can be humanized.
In one embodiment, an anti- c-met antibody comprises HVRs as in any of the above embodiments,
and further comprises an acceptor human framework, e.g. a human immunoglobulin framework
or a human consensus framework.
[0116] In another aspect, an anti- c-met antibody comprises a heavy chain variable domain
(VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or
100% sequence identity to the amino acid sequence of SEQ ID NO:7. In certain embodiments,
a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%
identity contains substitutions (e.g., conservative substitutions), insertions, or
deletions relative to the reference sequence, but an anti- c-met antibody comprising
that sequence retains the ability to bind to human c-met. In certain embodiments,
a total of 1 to 10 amino acids have been substituted, altered inserted and/or deleted
in SEQ ID NO:7. In certain embodiments, substitutions, insertions, or deletions occur
in regions outside the HVRs (i.e., in the FRs). Optionally, the anti-c-met antibody
comprises the VH sequence in SEQ ID NO:7, including post-translational modifications
of that sequence.
[0117] In another aspect, an anti- c-met antibody is provided, wherein the antibody comprises
a light chain variable domain (VL) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%,
97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO:8.
In certain embodiments, a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%,
96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions),
insertions, or deletions relative to the reference sequence, but an anti- c-met antibody
comprising that sequence retains the ability to bind to c-met. In certain embodiments,
a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in SEQ
ID NO:8. In certain embodiments, the substitutions, insertions, or deletions occur
in regions outside the HVRs (i.e., in the FRs). Optionally, the anti- c-met antibody
comprises the VL sequence in SEQ ID NO: 8, including post-translational modifications
of that sequence.
[0118] In yet another embodiment, the anti- c-met antibody comprises a VL region having
at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
to the amino acid sequence of SEQ ID NO:8 and a VH region having at least 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid
sequence of SEQ ID NO:7. In yet a further embodiment, the anti- c-met antibody comprises
a HVR-L1 comprising amino acid sequence SEQ ID NO: 1; an HVR-L2 comprising amino acid
sequence SEQ ID NO: 2; an HVR-L3 comprising amino acid sequence SEQ ID NO: 3; an HVR-H1
comprising amino acid sequence SEQ ID NO: 4; an HVR-H2 comprising amino acid sequence
SEQ ID NO: 5; and an HVR-H3 comprising amino acid sequence SEQ ID NO: 6.
[0119] In another aspect, an anti- c-met antibody is provided, wherein the antibody comprises
a VH as in any of the embodiments provided above, and a VL as in any of the embodiments
provided above.
[0120] In a further aspect, the invention provides an antibody that binds to the same epitope
as an anti- c-met antibody provided herein. For example, in certain embodiments, an
antibody is provided that binds to the same epitope as or can by competitively inhibited
by an anti- c-met antibody comprising a VH sequence of SEQ ID NO:7 and a VL sequence
of SEQ ID NO:8.
[0121] In a further aspect of the invention, an anti- c-met antibody according to any of
the above embodiment can be a monoclonal antibody, including a monovalent, chimeric,
humanized or human antibody. In one embodiment, an anti- c-met antibody is an antibody
fragment, e.g., a one-armed, Fv, Fab, Fab', scFv, diabody, or F(ab')
2 fragment. In another embodiment, the antibody is a full length antibody, e.g., an
intact IgG1 or IgG4 antibody or other antibody class or isotype as defined herein.
According to another embodiment, the antibody is a bispecific antibody. In one embodiment,
the bispecific antibody comprises the HVRs or comprises the VH and VL regions described
above.
[0122] In some embodiments, the anti-c-met antibody is monovalent, and comprises (a) a first
polypeptide comprising a heavy chain variable domain having the sequence:

CH1 sequence, and a first Fc polypeptide; (b) a second polypeptide
comprising a light chain variable domain having the sequence:

and CL1 sequence; and (c) a third polypeptide comprising a second Fc polypeptide,
wherein the heavy chain variable domain and the light chain variable domain are present
as a complex and form a single antigen binding arm, wherein the first and second Fc
polypeptides are present in a complex and form a Fc region that increases stability
of said antibody fragment compared to a Fab molecule comprising said antigen binding
arm. In some embodiments, the first polypeptide comprises Fc sequence

and the second polypeptide comprises the Fc sequence

[0123] In another embodiments, the anti-c-met antibody is monovalent and comprises (a) a
first polypeptide comprising a heavy chain, said polypeptide comprising the sequence:

(b) a second polypeptide comprising a light chain, the polypeptide comprising the
sequence

and a third polypeptide comprising a Fc sequence, the polypeptide comprising the sequence

wherein the heavy chain variable domain and the light chain variable domain are present
as a complex and form a single antigen binding arm, wherein the first and second Fc
polypeptides are present in a complex and form a Fc region that increases stability
of said antibody fragment compared to a Fab molecule comprising said antigen binding
arm.
[0124] Other anti-c-met antibodies suitable for use in the methods of the invention are
described herein and known in the art. For example, anti-c-met antibodies disclosed
in
WO05/016382 (including but not limited to antibodies 13.3.2, 9.1.2, 8.70.2, 8.90.3); an anti-c-met
antibodies produced by the hybridoma cell line deposited with ICLC number PD 03001
at the CBA in Genoa, or that recognizes an epitope on the extracellular domain of
the β chain of the HGF receptor, and said epitope is the same as that recognized by
the monoclonal antibody); anti-c-met antibodies disclosed in
WO2007/126799 (including but not limited to 04536, 05087, 05088, 05091, 05092, 04687, 05097, 05098,
O5100, O51 Ol , 04541, 05093, 05094, 04537, 05102, 05105, 04696, 04682); anti c-met
antibodies disclosed in
WO2009/007427 (including but not limited to an antibody deposited at CNCM, Institut Pasteur, Paris,
France, on March 14, 2007 under the number 1-3731, on March 14, 2007 under the number
1-3732, on July 6, 2007 under the number I-3786, on March 14, 2007 under the number
I-3724; an anti-c-met antibody disclosed in 20110129481; an anti-c-met antibody disclosed
in
US20110104176; an anti-c-met antibody disclosed in
WO2009/134776; an anti-c-met antibody disclosed in
WO2010/059654; an anti-c-met antibody disclosed in
WO2011020925 (including but not limited to an antibody secreted from a hybridoma deposited at
the CNCM, Institut Pasteur, Paris, France, on march 12, 2008 under the number I-3949
and the hybridoma deposited on January 14, 2010 under the number I-4273).
[0125] In one aspect, the anti-c-met antibody comprises at least one characteristic that
promotes heterodimerization, while minimizing homodimerization, of the Fc sequences
within the antibody fragment. Such characteristic(s) improves yield and/or purity
and/or homogeneity of the immunoglobulin populations. In one embodiment, the antibody
comprises Fc mutations constituting "knobs" and "holes" as described in
WO2005/063816. For example, a hole mutation can be one or more of T366A, L368A and/or Y407V in
an Fc polypeptide, and a cavity mutation can be T366W.
[0126] In some embodiments, the c-met antagonist is an anti-hepatocyte growth factor (HGF)
antibody, for example, humanized anti-HGF antibody TAK701, rilotumumab, Ficlatuzumab,
and/or humanized antibody 2B8 described in
WO2007/143090 In some embodiments, the anti-HGF antibody is the anti-HGF antibody described in
US7718174B2.
[0127] In some embodiments, the c-met antagonist is a c-met small molecule inhibitor. In
some embodiments, the c-met small molecule inhibitor is a selective c-met small molecule
inhibitor.
[0128] In one embodiment, the c-met antagonist binds c-met extracellular domain. In some
embodiments, the c-met antagonist binds c-met kinase domain. In some embodiments,
the c-met antagonist competes for c-met binding with hepatocyte growth factor (HGF).
In some embodiments, the c-met antagonist binds HGF. In certain embodiments, the c-met
antagonist inhibits cell proliferation, e.g., HGF-induced cell proliferation of cell
line EBC-1, H441 and/or KP4. In some embodiments, cell proliferation is inhibited
with a Ki of 600 nM or less (more potent), 500 nM or less, 400 nM or less, 300 nM
or less or more potent. In certain embodiments, the c-met antagonist inhibits c-met
signaling (e.g., phospho-c-met, phospho-AKT, phospho-MAPK) when EBC-1 cells are treated
with c-met antagonist in the presence of 10% fetal bovine serum. In some embodiments,
c-met signaling is inhibited with a Ki of 600 nM or less (more potent), 500 nM or
less, 400 nM or less, 300 nM or less (more potent). In certain embodiments, the c-met
antagonist treats (is capable of treating) squamous cell carcinoma. In certain embodiments,
the c-met antagonist treats (is capable of treating) NSCLC that expresses wild-type
k-ras.
[0129] In certain embodiments, the c-met inhibitor is not a non-ATP-competitive small molecule.
In certain embodiments, the c-met antagonist inhibits cell proliferation, e.g., HGF-induced
cell proliferation of cell line EBC-1, H441 and/or KP4. In certain embodiments, the
c-met antagonist inhibits c-met signaling (e.g., phospho-c-met, and downstream c-met
signaling pathways, e.g., phospho-AKT, phospho-MAPK) when EBC-1 cells are treated
with c-met antagonist in the presence of 10% fetal bovine serum. In certain embodiments,
the c-met antagonist does not inhibit cell proliferation of cell lines MDA-MB-231
and HT29 (in the presence or absence of exogenous HGF). In certain embodiments, the
c-met antagonist does not inhibit cell proliferation of cell lines MDA-MB-231 and
HT29 in the presence of 10% fetal bovine serum. Methods for assaying cell proliferation
are well-known in the art, and some methods are described in
WO2009/111691;
WO2006/015371; and
Jin et al, Cancer Res (2008) 68:4360. In certain embodiments, the c-met antagonist treats (is capable of treating) squamous
cell carcinoma. In certain embodiments, the c-met antagonist treats (is capable of
treating) NSCLC that expresses wild-type k-ras. In certain embodiments, the c-met
antagonist is not Tivantinib (ARQ-197). In a particular embodiment, a c-met antagonist
inhibits c-met signaling with an IC50 of 1,000 nM or less (i.e., more potent). In
another embodiment, a c-met antagonist inhibits c-met signaling with an IC50 of 400
nm or less, 500 nM or less, 600 nm or less, 700 nm or less. In another embodiment,
a c-met antagonist inhibits c-met signaling with an IC50 of 50 nM or less. In certain
embodiments, the c-met antagonist is not crizotinib. In certain embodiments, the c-met
antagonist is not foretinib. In certain embodiments, the c-met antagonist is not ficlatuzumab.
[0130] In certain embodiments, the c-met antagonist is any one of: SGX-523, Crizotinib (PF-02341066;
3-[(1R)-1-(2,6-dichloro-3-fluorophenyl)ethoxy]-5-(1-piperidin-4-ylpyrazol-4-yl)pyridin-2-amine;
CAS no. 877399-52-5); JNJ-38877605 (
CAS no. 943540-75-8), BMS-698769, PHA-665752 (Pfizer), SU5416, INC-280 (Incyte; SU11274 (Sugen; [(3Z)-N-(3-chlorophenyl)-3-({3,5-dimethyl-4-[(4-methylpiperazin-1-yl)carbonyl]-1H-pyrrol-2-yl}methylene)-N-methyl-2-oxoindoline-5-sulfonamide;
CAS no. 658084-23-2]), Foretinib (GSK1363089), XL880 (
CAS no. 849217-64-7; XL880 is a inhibitor of met and VEGFR2 and KDR); MGCD-265 (MethylGene; MGCD-265
targets the c-MET, VEGFR1, VEGFR2, VEGFR3, Ron and Tie-2 receptors;
CAS no. 875337-44-3), Tivantinib (ARQ 197; (-)-(3R,4R)-3-(5,6-dihydro-4H-pyrrolo[3,2,1-ij]quinolin-1-yl)-4-(1H-indol-3-yl)pyrrolidine-2,5-dione;
see
Munchi et al, Mol Cancer Ther June 2010 9; 1544;
CAS no. 905854-02-6), LY-2801653 (Lilly), LY2875358 (Lilly), MP-470, Rilotumumab (AMG 102, anti-HGF monoclonal
antibody), antibody 223C4 or humanized antibody 223C4 (
WO2009/007427), humanized L2G7 (humanized TAK701; humanized anti-HGF monoclonal antibody); EMD
1214063 (Merck Sorono), EMD 1204831 (Merck Serono), NK4, Cabozantinib (XL-184,
CAS no. 849217-68-1; carbozantinib is a dual inhibitor of met and VEGFR2), MP-470 (SuperGen; is a novel
inhibitor of c-KIT, MET, PDGFR, Flt3, and AXL), Comp-1, Ficlatuzumab (AV-299; anti-HGF
monoclonal antibody), E7050 (
Cas no. 1196681-49-8; E7050 is a dual c-met and VEGFR2 inhibitor (Esai); MK-2461 (Merck; N-((2R)-1,4-Dioxan-2-ylmethyl)-N-methyl-N'-[3-(1-methyl-1H-pyrazol-4-yl)-5-oxo-5H-benzo[4,5]cyclohepta[1,2-b]pyridin-7-yl]sulfamide;
CAS no. 917879-39-1); MK8066 (Merck), PF4217903 (Pfizer), AMG208 (Amgen), SGX-126, RP1040, LY2801653,
AMG458, EMD637830, BAY-853474, DP-3590. In certain embodiments, the c-met antagonist
is any one or more of crizotinib, tivantinib, carbozantinib, MGCD-265, ficlatuzumab,
humanized TAK-701, rilotumumab, foretinib, h224G11, DN-30, MK-2461, E7050, MK-8033,
PF-4217903, AMG208, JNJ-38877605, EMD1204831, INC-280, LY-2801653, SGX-126, RP1040,
LY2801653, BAY-853474, and/or LA480. In certain embodiments, the c-met antagonist
is any one or more of crizotinib, tivantinib, carbozantinib, MGCD-265, ficlatuzumab,
humanized TAK-701, rilotumumab, and/or foretinib.
[0131] EGFR antagonists include antibodies such as humanized monoclonal antibody known as
nimotuzumab (YM Biosciences), fully human ABX-EGF (panitumumab, Abgenix Inc.) as well
as fully human antibodies known as E1.1, E2.4, E2.5, E6.2, E6.4, E2.11, E6. 3 and
E7.6. 3 and described in
US 6,235,883; MDX-447 (Medarex Inc). Pertuzumab (2C4) is a humanized antibody that binds directly
to HER2 but interferes with HER2-EGFR dimerization thereby inhibiting EGFR signaling.
Other examples of antibodies which bind to EGFR include MAb 579 (ATCC CRL HB 8506),
MAb 455 (ATCC CRL HB8507), MAb 225 (ATCC CRL 8508), MAb 528 (ATCC CRL 8509) (see,
US Patent No. 4,943, 533, Mendelsohn et al.) and variants thereof, such as chimerized 225 (C225 or Cetuximab; ERBUTIX®) and reshaped
human 225 (H225) (see,
WO 96/40210, Imclone Systems Inc.); IMC-11F8, a fully human, EGFR-targeted antibody (Imclone);
antibodies that bind type II mutant EGFR (
US Patent No. 5,212,290); humanized and chimeric antibodies that bind EGFR as described in
US Patent No. 5,891,996; and human antibodies that bind EGFR, such as ABX-EGF (see
WO98/50433, Abgenix); EMD 55900 (
Stragliotto et al. Eur. J. Cancer 32A:636-640 (1996)); EMD7200 (matuzumab) a humanized EGFR antibody directed against EGFR that competes
with both EGF and TGF-alpha for EGFR binding; and mAb 806 or humanized mAb 806 (
Johns et al., J. Biol. Chem. 279(29):30375-30384 (2004)). The anti-EGFR antibody may be conjugated with a cytotoxic agent, thus generating
an immunoconjugate (see,
e.g., EP659,439A2, Merck Patent GmbH).
[0132] Anti-EGFR antibodies that are useful in the methods of the invention include any
antibody that binds with sufficient affinity and specificity to EGFR and can reduce
or inhibit EGFR activity. The antibody selected will normally have a sufficiently
strong binding affinity for EGFR, for example, the antibody may bind human c-met with
a Kd value of between 100 nM-1 pM. Antibody affinities maybe determined by a surface
plasmon resonance based assay (such as the BIAcore assay as described in
PCT Application Publication No. WO2005/012359); enzyme-linked immunoabsorbent assay (ELISA); and competition assays (e.g. RIA's),
for example. Preferably, the anti-EGFR antibody of the invention can be used as a
therapeutic agent in targeting and interfering with diseases or conditions wherein
EGFR/EGFR ligand activity is involved. Also, the antibody may be subjected to other
biological activity assays, e.g., in order to evaluate its effectiveness as a therapeutic.
Such assays are known in the art and depend on the target antigen and intended use
for the antibody.
[0133] Bispecific antibodies are antibodies that have binding specificities for at least
two different epitopes. Exemplary bispecific antibodies may bind to EGFR and to c-met.
In another example, an exemplary bispecific antibody may bind to two different epitopes
of the same protein, e.g., c-met protein. Alternatively, a c-met or EGFR arm may be
combined with an arm which binds to a triggering molecule on a leukocyte such as a
T-cell receptor molecule (e.g. CD2 or CD3), or Fc receptors for IgG (FcγR), such as
FcγRI (CD64), FcγRII (CD32) and FcγRIII (CD16) so as to focus cellular defense mechanisms
to the c-met or EGFR-expressing cell. Bispecific antibodies may also be used to localize
cytotoxic agents to cells which express EGFR or c-met. These antibodies possess a
EGFR or c-met-binding arm and an arm which binds the cytotoxic agent (e.g. saporin,
anti-interferon-α, vinca alkaloid, ricin A chain, methotrexate or radioactive isotope
hapten). Bispecific antibodies can be prepared as full length antibodies or antibody
fragments (e.g. F(ab')2 bispecific antibodies). In one embodiment, the bispecific
antibody is any of the bispecific MET-EGFR antibodies disclosed in
US20100254989A.
[0134] EGFR antagonists also include small molecules such as compounds described in
US5616582,
US5457105,
US5475001,
US5654307,
US5679683,
US6084095,
US6265410,
US6455534,
US6521620,
US6596726,
US6713484,
US5770599,
US6140332,
US5866572,
US6399602,
US6344459,
US6602863,
US6391874,
WO9814451,
WO9850038,
WO9909016,
WO9924037,
WO9935146,
WO0132651,
US6344455,
US5760041,
US6002008,
US5747498. Particular small molecule EGFR antagonists include OSI-774 (CP-358774, erlotinib,
OSI Pharmaceuticals); PD 183805 (CI 1033, 2-propenamide, N-[4-[(3-chloro-4-fluorophenyl)amino]-7-[3-(4-morpholinyl)propoxy]-6-quinazolinyl]-,
dihydrochloride, Pfizer Inc.); Iressa
® (ZD1839, gefitinib, AstraZeneca); ZM 105180 ((6-amino-4-(3-methylphenylamino)-quinazoline,
Zeneca); BIBX-1382 (N8-(3-chloro-4-fluoro-phenyl)-N2-(1-methyl-piperidin-4-yl)-pyrimido[5,4-d]pyrimidine-2,8-diamine,
Boehringer Ingelheim); PKI-166 ((R)-4-[4-[(1-phenylethyl)amino]-1H-pyrrolo[2,3-d]pyrimidin-6-yl]-phenol);
(R)-6-(4-hydroxyphenyl)-4-[(1-phenylethyl)amino]-7H-pyrrolo[2,3-d]pyrimidine); CL-387785
(N-[4-[(3-bromophenyl)amino]-6-quinazolinyl]-2-butynamide); EKB-569 (N-[4-[(3-chloro-4-fluorophenyl)amino]-3-cyano-7-ethoxy-6-quinolinyl]-4-(dimethylamino)-2-butenamide);
lapatinib (Tykerb, GlaxoSmithKline); ZD6474 (Zactima, AstraZeneca); CUDC-101 (Curis);
canertinib (CI-1033); AEE788 (6-[4-[(4-ethyl-1-piperazinyl)methyl]phenyl]-N-[(1R)-1-phenylethyl]-7H-pyrrolo[2,3-d]pyrimidin-4-amine,
WO2003013541, Novartis) and PKI166 4-[4-[[(1R)-1-phenylethyl]amino]-7H-pyrrolo[2,3-d]pyrimidin-6-yl]-phenol,
WO9702266 Novartis).
[0135] In one embodiment, the antibody, e.g. the antibody used in the methods herein may
incorporate any of the features, singly or in combination, as described in Sections
1-6 below:
1. Antibody Fragments
[0136] In certain embodiments, an antibody provided herein is an antibody fragment. Antibody
fragments include, but are not limited to, Fab, Fab', Fab'-SH, F(ab')
2, Fv, and scFv fragments, a one-armed antibody, and other fragments described below.
For a review of certain antibody fragments, see
Hudson et al. Nat. Med. 9:129-134 (2003). For a review of scFv fragments, see, e.g.,
Pluckthün, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore
eds., (Springer-Verlag, New York), pp. 269-315 (1994); see also
WO 93/16185; and
U.S. Patent Nos. 5,571,894 and
5,587,458. For discussion of Fab and F(ab')
2 fragments comprising salvage receptor binding epitope residues and having increased
in vivo half-life, see
U.S. Patent No. 5,869,046.
[0138] Single-domain antibodies are antibody fragments comprising all or a portion of the
heavy chain variable domain or all or a portion of the light chain variable domain
of an antibody. In certain embodiments, a single-domain antibody is a human single-domain
antibody (Domantis, Inc., Waltham, MA;
see, e.g.,
U.S. Patent No. 6,248,516 B1).
[0139] One-armed antibodies (i.e., the heavy chain variable domain and the light chain variable
domain form a single antigen binding arm) are disclosed in, for example,
WO2005/063816;
Martens et al, Clin Cancer Res (2006), 12: 6144. For treatment of pathological conditions requiring an antagonistic function, and
where bivalency of an antibody results in an undesirable agonistic effect, the monovalent
trait of a one-armed antibody (i.e., an antibody comprising a single antigen binding
arm) results in and/or ensures an antagonistic function upon binding of the antibody
to a target molecule. Furthermore, the one-armed antibody comprising a Fc region is
characterized by superior pharmacokinetic attributes (such as an enhanced half life
and/or reduced clearance rate
in vivo) compared to Fab forms having similar/substantially identical antigen binding characteristics,
thus overcoming a major drawback in the use of conventional monovalent Fab antibodies.
Techniques for making one-armed antibodies include, but are not limited to, "knob-in-hole"
engineering (see, e.g.,
U.S. Patent No. 5,731,168). MetMAb is an example of a one-armed antibody. [add other one armed monovalent formats?
Genmab?]
[0140] Antibody fragments can be made by various techniques, including but not limited to
proteolytic digestion of an intact antibody as well as production by recombinant host
cells (e.g.
E. coli or phage), as described herein.
2. Chimeric and Humanized Antibodies
[0141] In certain embodiments, an antibody provided herein is a chimeric antibody. Certain
chimeric antibodies are described, e.g., in
U.S. Patent No. 4,816,567; and
Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984)). In one example, a chimeric antibody comprises a non-human variable region (e.g.,
a variable region derived from a mouse, rat, hamster, rabbit, or non-human primate,
such as a monkey) and a human constant region. In a further example, a chimeric antibody
is a "class switched" antibody in which the class or subclass has been changed from
that of the parent antibody. Chimeric antibodies include antigen-binding fragments
thereof.
[0142] In certain embodiments, a chimeric antibody is a humanized antibody. Typically, a
non-human antibody is humanized to reduce immunogenicity to humans, while retaining
the specificity and affinity of the parental non-human antibody. Generally, a humanized
antibody comprises one or more variable domains in which HVRs, e.g., CDRs, (or portions
thereof) are derived from a non-human antibody, and FRs (or portions thereof) are
derived from human antibody sequences. A humanized antibody optionally will also comprise
at least a portion of a human constant region. In some embodiments, some FR residues
in a humanized antibody are substituted with corresponding residues from a non-human
antibody (e.g., the antibody from which the HVR residues are derived), e.g., to restore
or improve antibody specificity or affinity.
[0143] Humanized antibodies and methods of making them are reviewed, e.g., in
Almagro and Fransson, Front. Biosci. 13:1619-1633 (2008), and are further described, e.g., in
Riechmann et al., Nature 332:323-329 (1988);
Queen et al., Proc. Nat'l Acad. Sci. USA 86:10029-10033 (1989);
US Patent Nos. 5, 821,337,
7,527,791,
6,982,321, and
7,087,409;
Kashmiri et al., Methods 36:25-34 (2005) (describing SDR (a-CDR) grafting);
Padlan, Mol. Immunol. 28:489-498 (1991) (describing "resurfacing");
Dall'Acqua et al., Methods 36:43-60 (2005) (describing "FR shuffling"); and
Osbourn et al., Methods 36:61-68 (2005) and
Klimka et al., Br. J. Cancer, 83:252-260 (2000) (describing the "guided selection"
approach to FR shuffling).
[0144] Human framework regions that may be used for humanization include but are not limited
to: framework regions selected using the "best-fit" method (see, e.g.,
Sims et al. J. Immunol. 151:2296 (1993)); framework regions derived from the consensus sequence of human antibodies of a
particular subgroup of light or heavy chain variable regions (see, e.g.,
Carter et al. Proc. Natl. Acad. Sci. USA, 89:4285 (1992); and
Presta et al. J. Immunol., 151:2623 (1993)); human mature (somatically mutated) framework regions or human germline framework
regions (see, e.g.,
Almagro and Fransson, Front. Biosci. 13:1619-1633 (2008)); and framework regions derived from screening FR libraries (see, e.g.,
Baca et al., J. Biol. Chem. 272:10678-10684 (1997) and
Rosok et al., J. Biol. Chem. 271:22611-22618 (1996)).
3. Human Antibodies
[0146] Human antibodies may be prepared by administering an immunogen to a transgenic animal
that has been modified to produce intact human antibodies or intact antibodies with
human variable regions in response to antigenic challenge. Such animals typically
contain all or a portion of the human immunoglobulin loci, which replace the endogenous
immunoglobulin loci, or which are present extrachromosomally or integrated randomly
into the animal's chromosomes. In such transgenic mice, the endogenous immunoglobulin
loci have generally been inactivated. For review of methods for obtaining human antibodies
from transgenic animals, see
Lonberg, Nat. Biotech. 23:1117-1125 (2005). See also, e.g.,
U.S. Patent Nos. 6,075,181 and
6,150,584 describing XENOMOUSE™ technology;
U.S. Patent No. 5,770,429 describing HuMAB® technology;
U.S. Patent No. 7,041,870 describing K-M MOUSE® technology, and U.S. Patent Application Publication No.
US 2007/0061900, describing VELOCIMOUSE® technology). Human variable regions from intact antibodies
generated by such animals may be further modified, e.g., by combining with a different
human constant region.
[0147] Human antibodies can also be made by hybridoma-based methods. Human myeloma and mouse-human
heteromyeloma cell lines for the production of human monoclonal antibodies have been
described. (See, e.g.,
Kozbor J. Immunol., 133: 3001 (1984);
Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63
(Marcel Dekker, Inc., New York, 1987); and
Boerner et al., J. Immunol., 147: 86 (1991).) Human antibodies generated via human B-cell hybridoma technology are also described
in
Li et al., Proc. Natl. Acad. Sci. USA, 103:3557-3562 (2006). Additional methods include those described, for example, in
U.S. Patent No. 7,189,826 (describing production of monoclonal human IgM antibodies from hybridoma cell lines)
and
Ni, Xiandai Mianyixue, 26(4):265-268 (2006) (describing human-human hybridomas). Human hybridoma technology (Trioma technology)
is also described in
Vollmers and Brandlein, Histology and Histopathology, 20(3):927-937 (2005) and
Vollmers and Brandlein, Methods and Findings in Experimental and Clinical Pharmacology,
27(3):185-91 (2005).
[0148] Human antibodies may also be generated by isolating Fv clone variable domain sequences
selected from human-derived phage display libraries. Such variable domain sequences
may then be combined with a desired human constant domain. Techniques for selecting
human antibodies from antibody libraries are described below.
4. Library-Derived Antibodies
[0149] Antibodies of the invention may be isolated by screening combinatorial libraries
for antibodies with the desired activity or activities. For example, a variety of
methods are known in the art for generating phage display libraries and sereening
such libraries for antibodies possessing the desired binding characteristics. Such
methods are reviewed, e.g., in
Hoogenboom et al. in Methods in Molecular Biology 178:1-37 (O'Brien et al., ed., Human
Press, Totowa, NJ, 2001) and further described, e.g., in the
McCafferty et al., Nature 348:552-554;
Clackson et al., Nature 352: 624-628 (1991);
Marks et al., J. Mol. Biol. 222: 581-597 (1992);
Marks and Bradbury, in Methods in Molecular Biology 248:161-175 (Lo, ed., Human Press,
Totowa, NJ, 2003);
Sidhu et al., J. Mol. Biol. 338(2): 299-310 (2004);
Lee et al., J. Mol. Biol. 340(5): 1073-1093 (2004);
Fellouse, Proc. Natl. Acad. Sci. USA 101(34): 12467-12472 (2004); and
Lee et al., J. Immunol. Methods 284(1-2): 119-132(2004).
[0150] In certain phage display methods, repertoires of VH and VL genes are separately cloned
by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which
can then be screened for antigen-binding phage as described in
Winter et al., Ann. Rev. Immunol., 12: 433-455 (1994). Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments
or as Fab fragments. Libraries from immunized sources provide high-affinity antibodies
to the immunogen without the requirement of constructing hybridomas. Alternatively,
the naive repertoire can be cloned (e.g., from human) to provide a single source of
antibodies to a wide range of non-self and also self antigens without any immunization
as described by
Griffiths et al., EMBO J, 12: 725-734 (1993). Finally, naive libraries can also be made synthetically by cloning unrearranged
V-gene segments from stem cells, and using PCR primers containing random sequence
to encode the highly variable CDR3 regions and to accomplish rearrangement
in vitro, as described by
Hoogenboom and Winter, J. Mol. Biol., 227: 381-388 (1992). Patent publications describing human antibody phage libraries include, for example:
US Patent No. 5,750,373, and US Patent Publication Nos.
2005/0079574,
2005/0119455,
2005/0266000,
2007/0117126,
2007/0160598,
2007/0237764,
2007/0292936, and
2009/0002360.
[0151] Antibodies or antibody fragments isolated from human antibody libraries are considered
human antibodies or human antibody fragments herein.
5. Multispecific Antibodies
[0152] In certain embodiments, an antibody provided herein is a multispecific antibody,
e.g. a bispecific antibody. Multispecific antibodies are monoclonal antibodies that
have binding specificities for at least two different sites. In certain embodiments,
one of the binding specificities is for c-met and the other is for any other antigen.
In certain embodiments, bispecific antibodies may bind to two different epitopes of
c-met. Bispecific antibodies may also be used to localize cytotoxic agents to cells
which express c-mct. Bispecific antibodies can be prepared as full length antibodies
or antibody fragments.
[0153] Techniques for making multispecific antibodies include, but are not limited to, recombinant
co-expression of two immunoglobulin heavy chain-light chain pairs having different
specificities (see
Milstein and Cuello, Nature 305: 537 (1983),
WO 93/08829, and
Traunecker et al., EMBO J. 10: 3655 (1991)), and "knob-in-hole" engineering (see, e.g.,
U.S. Patent No. 5,731,168). Multi-specific antibodies may also be made by engineering electrostatic steering
effects for making antibody Fc-heterodimeric molecules (
WO 2009/089004A1); crosslinking two or more antibodies or fragments (see, e.g.,
US Patent No. 4,676,980, and
Brennan et al., Science, 229: 81 (1985)); using leucine zippers to produce bi-specific antibodies (see, e.g.,
Kostelny et al., J. Immunol., 148(5):1547-1553 (1992)); using "diabody" technology for making bispecific antibody fragments (see, e.g.,
Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993)); and using single-chain Fv (sFv) dimers (see,e.g.
Gruber et al., J. Immunol., 152:5368 (1994)); and preparing trispecific antibodies as described, e.g., in
Tutt et al. J. Immunol. 147: 60 (1991).
[0154] Engineered antibodies with three or more functional antigen binding sites, including
"Octopus antibodies," are also included herein (see, e.g.
US 2006/0025576A1).
[0155] The antibody or fragment herein also includes a "Dual Acting FAb" or "DAF" comprising
an antigen binding site that binds to c-met as well as another, different antigen,
such as EGFR (see,
US 2008/0069820, for example).
6. Antibody Variants
[0156] In certain embodiments, amino acid sequence variants of the antibodies provided herein
are contemplated. For example, it may be desirable to improve the binding affinity
and/or other biological properties of the antibody. Amino acid sequence variants of
an antibody may be prepared by introducing appropriate modifications into the nucleotide
sequence encoding the antibody, or by peptide synthesis. Such modifications include,
for example, deletions from, and/or insertions into and/or substitutions of residues
within the amino acid sequences of the antibody. Any combination of deletion, insertion,
and substitution can be made to arrive at the final construct, provided that the final
construct possesses the desired characteristics, e.g., antigen-binding.
[0157] In certain embodiments, antibody variants having one or more amino acid substitutions
are provided. Sites of interest for substitutional mutagenesis include the HVRs and
FRs. Amino acid substitutions may be introduced into an antibody of interest and the
products screened for a desired activity, e.g., retained/improved antigen binding,
decreased immunogenicity, or improved ADCC or CDC.
[0158] One type of substitutional variant involves substituting one or more hypervariable
region residues of a parent antibody (
e.g. a humanized or human antibody). Generally, the resulting variant(s) selected for
further study will have modifications (e.g., improvements) in certain biological properties
(e.g., increased affinity, reduced immunogenicity) relative to the parent antibody
and/or will have substantially retained certain biological properties of the parent
antibody. An exemplary substitutional variant is an affinity matured antibody, which
may be conveniently generated, e.g., using phage display-based affinity maturation
techniques such as those described herein. Briefly, one or more HVR residues are mutated
and the variant antibodies displayed on phage and screened for a particular biological
activity (e.g. binding affinity).
[0159] Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging
in length from one residue to polypeptides containing a hundred or more residues,
as well as intrasequence insertions of single or multiple amino acid residues. Examples
of terminal insertions include an antibody with an N-terminal methionyl residue. Other
insertional variants of the antibody molecule include the fusion to the N- or C-terminus
of the antibody to an enzyme (e.g. for ADEPT) or a polypeptide which increases the
serum half-life of the antibody.
[0160] In certain embodiments, an antibody provided herein is altered to increase or decrease
the extent to which the antibody is glycosylated. Addition or deletion of glycosylation
sites to an antibody may be conveniently accomplished by altering the amino acid sequence
such that one or more glycosylation sites is created or removed.
[0161] Where the antibody comprises an Fc region, the carbohydrate attached thereto may
be altered. Native antibodies produced by mammalian cells typically comprise a branched,
biantennary oligosaccharide that is generally attached by an N-linkage to Asn297 of
the CH2 domain of the Fc region. See, e.g.,
Wright et al. TIBTECH 15:26-32 (1997). The oligosaccharide may include various carbohydrates, e.g., mannose, N-acetyl
glucosamine (GlcNAc), galactose, and sialic acid, as well as a fucose attached to
a GlcNAc in the "stem" of the biantennary oligosaccharide structure. In some embodiments,
modifications of the oligosaccharide in an antibody of the invention may be made in
order to create antibody variants with certain improved properties.
[0162] In one embodiment, antibody variants are provided having a carbohydrate structure
that lacks fucose attached (directly or indirectly) to an Fc region. For example,
the amount of fucose in such antibody may be from 1% to 80%, from 1% to 65%, from
5% to 65% or from 20% to 40%. The amount of fucose is determined by calculating the
average amount of fucose within the sugar chain at Asn297, relative to the sum of
all glycostructures attached to Asn 297 (e. g. complex, hybrid and high mannose structures)
as measured by MALDI-TOF mass spectrometry, as described in
WO 2008/077546, for example. Asn297 refers to the asparagine residue located at about position 297
in the Fc region (Eu numbering of Fc region residues); however, Asn297 may also be
located about ± 3 amino acids upstream or downstream of position 297, i.e., between
positions 294 and 300, due to minor sequence variations in antibodies. Such fucosylation
variants may have improved ADCC function. See, e.g., US Patent Publication Nos.
US 2003/0157108 (Presta, L.);
US 2004/0093621 (Kyowa Hakko Kogyo Co., Ltd). Examples of publications related to "defucosylated"
or "fucose-deficient" antibody variants include:
US 2003/0157108;
WO 2000/61739;
WO 2001/29246;
US 2003/0115614;
US 2002/0164328;
US 2004/0093621;
US 2004/0132140;
US 2004/0110704;
US 2004/0110282;
US 2004/0109865;
WO 2003/085119;
WO 2003/084570;
WO 2005/035586;
WO 2005/035778;
WO2005/053742;
WO2002/031140;
Okazaki et al. J. Mol. Biol. 336:1239-1249 (2004);
Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004). Examples of cell lines capable of producing defucosylated antibodies include Lec13
CHO cells deficient in protein fucosylation (
Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986); US Pat Appl No
US 2003/0157108 A1, Presta, L; and
WO 2004/056312 A1, Adams et al., especially at Example 11), and knockout cell lines, such as alpha-1,6-fucosyltransferase
gene,
FUT8, knockout CHO cells (see, e.g.,
Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004);
Kanda, Y. et al., Biotechnol. Bioeng., 94(4):680-688 (2006); and
WO2003/085107).
[0163] Antibodies variants are further provided with bisected oligosaccharides, e.g., in
which a biantennary oligosaccharide attached to the Fc region of the antibody is bisected
by GlcNAc. Such antibody variants may have reduced fucosylation and/or improved ADCC
function. Examples of such antibody variants are described, e.g., in
WO 2003/011878 (Jean-Mairet et al.);
US Patent No. 6,602,684 (Umana et al.); and
US 2005/0123546 (Umana et al.). Antibody variants with at least one galactose residue in the oligosaccharide attached
to the Fc region are also provided. Such antibody variants may have improved CDC function.
Such antibody variants are described, e.g., in
WO 1997/30087 (Patel et al.);
WO 1998/58964 (Raju, S.); and
WO 1999/22764 (Raju, S.).
[0164] In certain embodiments, one or more amino acid modifications may be introduced into
the Fc region of an antibody provided herein, thereby generating an Fc region variant.
The Fc region variant may comprise a human Fc region sequence (
e.g., a human IgG1, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification
(
e.g. a substitution) at one or more amino acid positions.
[0165] In certain embodiments, the invention contemplates an antibody variant that possesses
some but not all effector functions, which make it a desirable candidate for applications
in which the half life of the antibody
in vivo is important yet certain effector functions (such as complement and ADCC) are unnecessary
or deleterious.
[0166] Antibodies with reduced effector function include those with substitution of one
or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Patent No.
6,737,056). Such Fc mutants include Fc mutants with substitutions at two or more of amino acid
positions 265, 269, 270, 297 and 327, including the so-called "DANA" Fc mutant with
substitution of residues 265 and 297 to alanine (
US Patent No. 7,332,581).
[0168] In certain embodiments, an antibody variant comprises an Fc region with one or more
amino acid substitutions which improve ADCC, e.g., substitutions at positions 298,
333, and/or 334 of the Fc region (EU numbering of residues).
[0170] Antibodies with increased half lives and improved binding to the neonatal Fc receptor
(FcRn), which is responsible for the transfer of maternal IgGs to the fetus (
Guyer et al., J. Immunol. 117:587 (1976) and
Kim et al., J. Immunol. 24:249 (1994)), are described in
US2005/0014934A1 (Hinton et al.). Those antibodies comprise an Fc region with one or more substitutions therein which
improve binding of the Fc region to FcRn. Such Fc variants include those with substitutions
at one or more of Fc region residues: 238, 256, 265, 272, 286, 303, 305, 307, 311,
312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434, e.g., substitution
of Fc region residue 434 (
US Patent No. 7,371,826).
[0172] In certain embodiments, it may be desirable to create cysteine engineered antibodies,
e.g., "thioMAbs," in which one or more residues of an antibody are substituted with
cysteine residues. In particular embodiments, the substituted residues occur at accessible
sites of the antibody. By substituting those residues with cysteine, reactive thiol
groups are thereby positioned at accessible sites of the antibody and may be used
to conjugate the antibody to other moieties, such as drug moieties or linker-drug
moieties, to create an immunoconjugate, as described further herein. In certain embodiments,
any one or more of the following residues may be substituted with cysteine: V205 (Kabat
numbering) of the light chain; A118 (EU numbering) of the heavy chain; and S400 (EU
numbering) of the heavy chain Fc region. Cysteine engineered antibodies may be generated
as described, e.g., in U.S. Patent No.
7,521,541.
[0173] In certain embodiments, an antibody provided herein may be further modified to contain
additional nonproteinaceous moieties that are known in the art and readily available.
The moieties suitable for derivatization of the antibody include but are not limited
to water soluble polymers. Non-limiting examples of water soluble polymers include,
but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene
glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone,
poly-1, 3-dioxolane, poly-1,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids
(either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene
glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide co-polymers,
polyoxyethylated polyols (e.g., glycerol), polyvinyl alcohol, and mixtures thereof.
Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its
stability in water. The polymer may be of any molecular weight, and may be branched
or unbranched. The number of polymers attached to the antibody may vary, and if more
than one polymer are attached, they can be the same or different molecules. In general,
the number and/or type of polymers used for derivatization can be determined based
on considerations including, but not limited to, the particular properties or functions
of the antibody to be improved, whether the antibody derivative will be used in a
therapy under defined conditions, etc.
[0174] In another embodiment, conjugates of an antibody and nonproteinaceous moiety that
may be selectively heated by exposure to radiation are provided. In one embodiment,
the nonproteinaceous moiety is a carbon nanotube (
Kam et al., Proc. Natl. Acad. Sci. USA 102: 11600-11605 (2005)). The radiation may be of any wavelength, and includes, but is not limited to, wavelengths
that do not harm ordinary cells, but which heat the nonproteinaceous moiety to a temperature
at which cells proximal to the antibody-nonproteinaceous moiety are killed.
[0175] In one embodiment, the medicament is an mmunoconjugate comprising an antibody (such
as a c-met antibody) conjugated to one or more cytotoxic agents, such as chemotherapeutic
agents or drugs, growth inhibitory agents, toxins (e.g., protein toxins, enzymatically
active toxins of bacterial, fungal, plant, or animal origin, or fragments thereof),
or radioactive isotopes.
[0176] In one embodiment, an immunoconjugate is an antibody-drug conjugate (ADC) in which
an antibody is conjugated to one or more drugs, including but not limited to a maytansinoid
(see U.S. Patent Nos.
5,208,020,
5,416,064 and European Patent
EP 0 425 235 B1); an auristatin such as monomethylauristatin drug moieties DE and DF (MMAE and MMAF)
(see
U.S. Patent Nos. 5,635,483 and
5,780,588, and
7,498,298); a dolastatin; a calicheamicin or derivative thereof (see U.S. Patent Nos.
5,712,374,
5,714,586,
5,739,116,
5,767,285,
5,770,701,
5,770,710,
5,773,001, and
5,877,296;
Hinman et al., Cancer Res. 53:3336-3342 (1993); and
Lode et al., Cancer Res. 58:2925-2928 (1998)); an anthracycline such as daunomycin or doxorubicin (see
Kratz et al., Current Med. Chem. 13:477-523 (2006);
Jeffrey et al., Bioorganic & Med. Chem. Letters 16:358-362 (2006);
Torgov et al., Bioconj. Chem. 16:717-721 (2005);
Nagy et al., Proc. Natl. Acad. Sci. USA 97:829-834 (2000);
Dubowchik et al., Bioorg. & Med. Chem. Letters 12:1529-1532 (2002);
King et al., J. Med. Chem. 45:4336-4343 (2002); and
U.S. Patent No. 6,630,579); methotrexate; vindesine; a taxane such as docetaxel, paclitaxel, larotaxel, tesetaxel,
and ortataxel; a trichothecene; and CC1065.
[0177] In another embodiment, an immunoconjugate comprises an antibody as described herein
conjugated to an enzymatically active toxin or fragment thereof, including but not
limited to diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin
A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain,
alphasarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins
(PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria
officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and
the tricothecenes.
[0178] In another embodiment, an immunoconjugate comprises an antibody as described herein
conjugated to a radioactive atom to form a radioconjugate. A variety of radioactive
isotopes are available for the production of radioconjugates. Examples include At
211, I
131, I
125, Y
90, Re
186, Re
188, Sm
153, Bi
212, P
32, Pb
212 and radioactive isotopes of Lu. When the radioconjugate is used for detection, it
may comprise a radioactive atom for scintigraphic studies, for example tc99m or I123,
or a spin label for nuclear magnetic resonance (NMR) imaging (also known as magnetic
resonance imaging, mri), such as iodine-123 again, iodine-131, indium-111, fluorine-19,
carbon-13, nitrogen-15, oxygen-17, gadolinium, manganese or iron.
[0179] Conjugates of an antibody and cytotoxic agent may be made using a variety of bifunctional
protein coupling agents such as N-succinimidyl-3-(2-pyridyldithio) propionate (SPDP),
succinimidyl-4-(N-maleimidomethyl) cyclohexane-1-carboxylate (SMCC), iminothiolane
(IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCl),
active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde),
bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives
(such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene
2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene).
For example, a ricin immunotoxin can be prepared as described in
Vitetta et al., Science 238:1098 (1987). Carbon-14-labeled 1-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic
acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide
to the antibody. See
WO94/11026. The linker may be a "cleavable linker" facilitating release of a cytotoxic drug
in the cell. For example, an acid-labile linker, peptidase-sensitive linker, photolabile
linker, dimethyl linker or disulfide-containing linker (
Chari et al., Cancer Res. 52:127-131 (1992);
U.S. Patent No. 5,208,020) may be used.
[0180] The immunuoconjugates or ADCs herein expressly contemplate, but are not limited to
such conjugates prepared with cross-linker reagents including, but not limited to,
BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS,
sulfo-GMBS, sulfo-KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, and sulfo-SMPB, and SVSB
(succinimidyl-(4-vinylsulfone)benzoate) which are commercially available (e.g., from
Pierce Biotechnology, Inc., Rockford, IL., U.S.A).
III. DIAGNOSTIC METHODS
[0181] In one aspect, the invention provides methods for identifying a cancer patient who
is likely to respond to treatment with a c-met antagonist comprising the step of determining
whether the patient's cancer has a high amount of c-met biomarker, wherein the c-met
biomarker expression indicates that the patient is likely to respond to treatment
with the c-met antagonist.
[0182] In another aspect, the invention provides methods for determining cancer patient
prognosis, comprising the step of determining whether the patient's cancer has a high
amount of c-met biomarker, wherein the c-met biomarker expression indicates that the
patient is likely to have increased overall survival (OS) and/or progression-free
survival (PFS) when the patient is treated with a c-met antagonist.
[0183] In another aspect, the invention provides methods for determining c-met biomarker
expression, comprising the step of determining whether a patient's cancer has a high
amount of c-met biomarker, wherein c-met biomarker expression is protein expression
and is determined in a sample from the patient using IHC, wherein high c-met biomarker
expression is 50% or more of the tumor cells with moderate c-met staining intensity,
combined moderate/high c-met staining intensity or high c-met staining intensity,
wherein c-met expression is detected using a c-met antibody, wherein the c-met biomarker
expression indicates that the patient is likely to have increased OS and/or PFS when
the patient is treated with a c-met antagonist.
[0184] In one aspect, the invention herein concerns a method for selecting a therapy for
a patient with cancer (e.g., NSCLC) comprising determining expression of a c-met biomarker
in a sample from the patient, and selecting a cancer medicament based on the level
of expression of the biomarker. In one embodiment, a high level of the biomarker(s)
will result in selection of a c-met antagonist, such as a c-met antibody for use in
treating the patient. In another embodiment, where the biomarker(s) are present a
low (i.e. low or substantially undetectable level), the patient will be selected for
a treatment with a cancer medicament other than a c-met antagonist. In some embodiments,
the sample is of the patient's cancer (e.g., NSCLC).
[0185] In one aspect, the invention provides a method of optimizing therapeutic efficacy
comprising determining c-met biomarker expression in a patient cancer sample. In some
embodiments, detection of high c-met biomarker means increased PFS and/or OS when
the patient is treated with a c-met antagonist. In some embodiments, detection of
low c-met biomarker means a decreased PFS and/or OS when the patient is treated with
the c-met antagonist. In some embodiments, the cancer is NSCLC.
[0186] In one aspect, the invention provides a method of determining patient prognosis,
comprising determining level of c-met biomarker in a patient cancer sample. In some
embodiments, high c-met biomarker means likelihood of decreased PFS and/or OS compared
to a patient whose cancer has low c-met biomarker. In some embodiments, high c-met
biomarker expression means increased PFS and/or OS when the patient is treated with
c-met antagonist. In some embodiments, low c-met biomarker expression means decreased
PFS and/or OS when the patient is treated with c-met antagonist. In some embodiments,
the cancer is NSCLC, and high c-met biomarker expression means increased PFS and/or
OS when the patient is treated with c-met antagonist in combination with EGFR antagonist.
In some embodiments, the cancer is NSCLC, and low c-met biomarker expression means
decreased PFS and/or OS when the patient is treated with c-met antagonist in combination
with EGFR antagonist.
[0187] In one aspect, amount of c-met biomarker is determined using a method comprising:
(a) performing IHC analysis of a sample (such as a patient cancer sample) with anti-c-met
antibody; and b) determining expression of a c-met biomarker in the sample. In some
embodiments, c-met IHC staining intensity is determined relative to a reference value.
In some embodiments, c-met biomarker expression is determined using a c-met staining
intensity scoring scheme is disclosed herein, e.g., in Table A in Section III.7 below.
In some embodiments, the method further comprises stratifying the patients based on
IHC score.
[0188] In one aspect, amount of c-met biomarker expression is determined using a method
comprising the step of determining expression of c-met biomarker in the sample (such
as a patient's cancer sample), wherein the patient's sample has been subjected to
IHC analysis using an anti-c-met antibody. In some embodiments, c-met IHC staining
intensity is determined relative to a reference value. In some embodiments, c-met
biomarker expression is determined using a c-met staining intensity scoring scheme
is disclosed herein, e.g., in Table A in Section III.7 below.
[0189] In some embodiments, IHC analysis further comprises morphological staining, either
prior to or thereafter. In one embodiment, hematoxylin is use for staining cellular
nucleic of the slides. Hematoxylin is widely available. An example of a suitable hematoxylin
is Hematoxylin II (Ventana). When lighter blue nuclei are desired, a bluing reagent
may be used following hematoxylin staining.
[0190] Detection of c-met biomarker using IHC is disclosed herein, and a c-met staining
intensity scoring scheme is disclosed herein, e.g., in Table A in Section III.7 below.
As is noted herein, other biomarkers may be detected. Exemplary other biomarkers are
disclosed herein. In some embodiments of any of the inventions disclosed herein, high
c-met biomarker expression is met diagnostic positive clinical status as defined in
accordance with Table A herein. In some embodiments of any of the inventions disclosed
herein, low c-met biomarker expression is met diagnostic negative clinical status
as defined in accordance with Table A herein.
[0191] In one aspect, amount of c-met biomarker is determined using a method comprising:
(a) performing gene expression profiling, PCR (such as rtPCR), RNN-seq, microarray
analysis, SAGE, MassARRAY technique, or FISH on a sample (such as a patient cancer
sample) with anti-c-met antibody; and b) determining expression of a c-met biomarker
in the sample. As is noted herein, other biomarkers may be detected. Exemplary other
biomarkers are disclosed herein.
[0192] A sample from the patient is tested for expression of one or more of the biomarkers
herein. The source of the tissue or cell sample may be solid tissue as from a fresh,
frozen and/or preserved organ or tissue sample or biopsy or aspirate; blood or any
blood constituents; bodily fluids such as cerebral spinal fluid, amniotic fluid, peritoneal
fluid, or interstitial fluid; cells from any time in gestation or development of the
subject. The tissue sample may contain compounds which are not naturally intermixed
with the tissue in nature such as preservatives, anticoagulants, buffers, fixatives,
nutrients, antibiotics, or the like. Examples of tumor samples herein include, but
are not limited to, tumor biopsies, tumor cells, serum or plasma, circulating plasma
proteins, ascitic fluid, primary cell cultures or cell lines derived from tumors or
exhibiting tumor-like properties, as well as preserved tumor samples, such as formalin-fixed,
paraffin-embedded tumor samples or frozen tumor samples. In one embodiment, the patient
sample is a formalin-fixed paraffin-embedded (FFPE) tumor sample (e.g., a NSCLC tumor
sample or a breast cancer tumor sample). The sample may be obtained prior to the patient's
treatment with a cancer medicament (such as an anti-c-met antagonist). The sample
may be obtained from the primary tumor or from a metastatic tumor. The sample may
be obtained when the cancer is first diagnosed or, for example, after the tumor has
metastasized. In some embodiments, the tumor sample is of lung, lymph node, liver
or brain.
[0193] Various methods for determining expression of mRNA, protein, or gene amplification
include, but are not limited to, gene expression profiling, polymerase chain reaction
(PCR) including quantitative real time PCR (qRT-PCR), RNA-Seq, FISH, microarray analysis,
serial analysis of gene expression (SAGE), MassARRAY, proteomics, immunohistochemistry
(IHC), etc. In some embodiments, protein expression is quantified. Such protein analysis
may be performed using IHC, e.g., on patient tumor samples.
[0194] Various exemplary methods for determining biomarker expression will now be described
in more detail.
1. Gene Expression Profiling
[0195] In general, methods of gene expression profiling can be divided into two large groups:
methods based on hybridization analysis of polynucleotides, and methods based on sequencing
of polynucleotides. The most commonly used methods known in the art for the quantification
of mRNA expression in a sample include northern blotting and
in situ hybridization (
Parker &Barnes, Methods in Molecular Biology 106:247-283 (1999)); RNAse protection assays (
Hod, Biotechniques 13:852- 854 (1992)); and polymerase chain reaction (PCR) (
Weis et al., Trends in Genetics 8:263-264 (1992)). Alternatively, antibodies may be employed that can recognize specific duplexes,
including DNA duplexes, RNA duplexes, and DNA-RNA hybrid duplexes or DNA- protein
duplexes. Representative methods for sequencing-based gene expression analysis include
Serial Analysis of Gene Expression (SAGE), and gene expression analysis by massively
parallel signature sequencing (MPSS).
2. Polymerase Chain Reaction (PCR)
[0196] Of the techniques listed above, a sensitive and flexible quantitative method is PCR,
which can be used to compare mRNA levels in different sample populations, in normal
and tumor tissues, with or without drug treatment, to characterize patterns of gene
expression, to discriminate between closely related mRNAs, and to analyze RNA structure.
[0197] The first step is the isolation of mRNA from a target sample. The starting material
is typically total RNA isolated from human tumors or tumor cell lines, and corresponding
normal tissues or cell lines, respectively. Thus RNA can be isolated from a variety
of primary tumors, including breast, lung, colon, prostate, brain, liver, kidney,
pancreas, spleen, thymus, testis, ovary, uterus, etc., tumor, or tumor cell lines,
with pooled DNA from healthy donors. If the source of mRNA is a primary tumor, mRNA
can be extracted, for example, from frozen or archived paraffin-embedded and fixed
(
e.g. formalin-fixed) tissue samples. General methods for mRNA extraction arc well known
in the art and arc disclosed in standard textbooks of molecular biology, including
Ausubel et al., Current Protocol of Molecular Biology, John Wiley and Sons (1997). Methods for RNA extraction from paraffin embedded tissues are disclosed, for example,
in
Rupp and Locker, Lab Invest. 56:A67 (1987), and
De Andrés et al., BioTechniques 18:42044 (1995). In particular, RNA isolation can be performed using purification kit, buffer set
and protease from commercial manufacturers, such as Qiagen, according to the manufacturer's
instructions. For example, total RNA from cells in culture can be isolated using Qiagen
RNeasy mini- columns. Other commercially available RNA isolation kits include MASTERPURE®
Complete DNA and RNA Purification Kit (EPICENTRE®, Madison, Wis.), and Paraffin Block
RNA Isolation Kit (Ambion, Inc.). Total RNA from tissue samples can be isolated using
RNA Stat-60 (Tel-Test). RNA prepared from tumor can be isolated, for example, by cesium
chloride density gradient centrifugation.
[0198] As RNA cannot serve as a template for PCR, the first step in gene expression profiling
by PCR is the reverse transcription of the RNA template into cDNA, followed by its
exponential amplification in a PCR reaction. The two most commonly used reverse transcriptases
are avilo myeloblastosis virus reverse transcriptase (AMV-RT) and Moloney murine leukemia
virus reverse transcriptase (MMLV-RT). The reverse transcription step is typically
primed using specific primers, random hexamers, or oligo-dT primers, depending on
the circumstances and the goal of expression profiling. For example, extracted RNA
can be reverse- transcribed using a GENEAMP™ RNA PCR kit (Perkin Elmer, Calif., USA),
following the manufacturer's instructions. The derived cDNA can then be used as a
template in the subsequent PCR reaction. Although the PCR step can use a variety of
thermostable DNA-dependent DNA polymerases, it typically employs the Taq DNA polymerase,
which has a 5'- 3' nuclease activity but lacks a 3'-5' proofreading endonuclease activity.
Thus, TAQMAN® PCR typically utilizes the 5'-nuclease activity of Taq or Tth polymerase
to hydrolyze a hybridization probe bound to its target amplicon, but any enzyme with
equivalent 5' nuclease activity can be used. Two oligonucleotide primers are used
to generate an amplicon typical of a PCR reaction. A third oligonucleotide, or probe,
is designed to detect nucleotide sequence located between the two PCR primers. The
probe is non-extendible by Taq DNA polymerase enzyme, and is labeled with a reporter
fluorescent dye and a quencher fluorescent dye. Any laser-induced emission from the
reporter dye is quenched by the quenching dye when the two dyes are located close
together as they are on the probe. During the amplification reaction, the Taq DNA
polymerase enzyme cleaves the probe in a template-dependent manner. The resultant
probe fragments disassociate in solution, and signal from the released reporter dye
is free from the quenching effect of the second fluorophore. One molecule of reporter
dye is liberated for each new molecule synthesized, and detection of the unquenched
reporter dye provides the basis for quantitative interpretation of the data.
[0199] TAQMAN® PCR can be performed using commercially available equipment, such as, for
example, ABI PRISM 7700® Sequence Detection System® (Perkin- Elmer-Applied Biosystems,
Foster City, Calif., USA), or Lightcycler (Roche Molecular Biochemicals, Mannheim,
Germany). In a preferred embodiment, the 5' nuclease procedure is run on a real-time
quantitative PCR device such as the ABI PRISM 7700® Sequence Detection System. The
system consists of a thermocycler, laser, charge- coupled device (CCD), camera and
computer. The system amplifies samples in a 96-well format on a thermocycler. During
amplification, laser- induced fluorescent signal is collected in real-time through
fiber optics cables for all 96 wells, and detected at the CCD. The system includes
software for running the instrument and for analyzing the data.
[0200] 5'-Nuclease assay data are initially expressed as Ct, or the threshold cycle. As
discussed above, fluorescence values are recorded during every cycle and represent
the amount of product amplified to that point in the amplification reaction. The point
when the fluorescent signal is first recorded as statistically significant is the
threshold cycle (Ct).
[0201] To minimize errors and the effect of sample-to-sample variation, PCR is usually performed
using an internal standard. The ideal internal standard is expressed at a constant
level among different tissues, and is unaffected by the experimental treatment. RNAs
most frequently used to normalize patterns of gene expression are mRNAs for the housekeeping
genes glyceraldehyde-3-phosphate-dehydrogenase (GAPDH) and P-actin.
[0202] A more recent variation of the PCR technique is quantitative real time PCR (qRT-PCR),
which measures PCR product accumulation through a dual-labeled fluorigenic probe (
i.e., TAQMAN® probe). Real time PCR is compatible both with quantitative competitive PCR,
where internal competitor for each target sequence is used for normalization, and
with quantitative comparative PCR using a normalization gene contained within the
sample, or a housekeeping gene for PCR. For further details see,
e.g. Held et al., Genome Research 6:986-994 (1996).
[0203] The steps of a representative protocol for profiling gene expression using fixed,
paraffin-embedded tissues as the RNA source, including mRNA isolation, purification,
primer extension and amplification are given in various published journal articles
(for example:
Godfrey et al., J. Molec. Diagnostics 2: 84-91 (2000);
Specht et al., Am. J. Pathol. 158: 419-29 (2001)). Briefly, a representative process starts with cutting about 10 microgram thick
sections of paraffin-embedded tumor tissue samples. The RNA is then extracted, and
protein and DNA are removed. After analysis of the RNA concentration, RNA repair and/or
amplification steps may be included, if necessary, and RNA is reverse transcribed
using gene specific promoters followed by PCR.
[0204] According to one aspect of the present invention, PCR primers and probes are designed
based upon intron sequences present in the gene to be amplified. In this embodiment,
the first step in the primer/probe design is the delineation of intron sequences within
the genes. This can be done by publicly available software, such as the DNA BLAT software
developed by
Kent, W., Genome Res. 12(4):656-64 (2002), or by the BLAST software including its variations. Subsequent steps follow well
established methods of PCR primer and probe design.
[0206] Factors considered in PCR primer design include primer length, melting temperature
(Tm), and G/C content, specificity, complementary primer sequences, and 3'-end sequence.
In general, optimal PCR primers are generally 17-30 bases in length, and contain about
20-80%, such as, for example, about 50-60% G+C bases. Tm's between 50 and 80° C.,
e.g. about 50 to 70° C. are typically preferred.
[0207] For further guidelines for PCR primer and probe design see,
e.g. Dieffenbach et al., "General Concepts for PCR Primer Design" in: PCR Primer, A Laboratory
Manual, Cold Spring Harbor Laboratory Press, New York, 1995, pp. 133-155;
Innis and Gelfand, "Optimization of PCRs" in: PCR Protocols, A Guide to Methods and
Applications, CRC Press, London, 1994, pp. 5-11; and
Plasterer, T. N. Primerselect: Primer and probe design. Methods Mol. Biol. 70:520-
527 (1997), the entire disclosures of which are hereby expressly incorporated by reference.
3. RNN-Seq
4. Microarrays
[0209] Differential gene expression can also be identified, or confirmed using the microarray
technique. Thus, the expression profile of breast cancer- associated genes can be
measured in either fresh or paraffin-embedded tumor tissue, using microarray technology.
In this method, polynucleotide sequences of interest (including cDNAs and oligonucleotides)
are plated, or arrayed, on a microchip substrate. The arrayed sequences are then hybridized
with specific DNA probes from cells or tissues of interest. Just as in the PCR method,
the source of mRNA typically is total RNA isolated from human tumors or tumor cell
lines, and corresponding normal tissues or cell lines. Thus RNA can be isolated from
a variety of primary tumors or tumor cell lines. If the source of mRNA is a primary
tumor, mRNA can be extracted, for example, from frozen or archived paraffin- embedded
and fixed (e.g. formalin-fixed) tissue samples, which are routinely prepared and preserved
in everyday clinical practice.
[0210] In a specific embodiment of the microarray technique, PCR amplified inserts of cDNA
clones are applied to a substrate in a dense array. Preferably at least 10,000 nucleotide
sequences are applied to the substrate. The microarrayed genes, immobilized on the
microchip at 10,000 elements each, are suitable for hybridization under stringent
conditions. Fluorescently labeled cDNA probes may be generated through incorporation
of fluorescent nucleotides by reverse transcription of RNA extracted from tissues
of interest. Labeled cDNA probes applied to the chip hybridize with specificity to
each spot of DNA on the array. After stringent washing to remove non-specifically
bound probes, the chip is scanned by confocal laser microscopy or by another detection
method, such as a CCD camera. Quantitation of hybridization of each arrayed element
allows for assessment of corresponding mRNA abundance. With dual color fluorescence,
separately labeled cDNA probes generated from two sources of RNA are hybridized pairwise
to the array. The relative abundance of the transcripts from the two sources corresponding
to each specified gene is thus determined simultaneously. The miniaturized scale of
the hybridization affords a convenient and rapid evaluation of the expression pattern
for large numbers of genes. Such methods have been shown to have the sensitivity required
to detect rare transcripts, which are expressed at a few copies per cell, and to reproducibly
detect at least approximately two-fold differences in the expression levels (
Schena et al., Proc. Natl. Acad. Sci. USA 93(2):106-149 (1996)). Microarray analysis can be performed by commercially available equipment, following
manufacturer's protocols, such as by using the Affymetrix GENCHIP™ technology, or
Incyte's microarray technology.
[0211] The development of microarray methods for large-scale analysis of gene expression
makes it possible to search systematically for molecular markers of cancer classification
and outcome prediction in a variety of tumor types.
5. Serial Analysis of Gene Expression (SAGE)
[0212] Serial analysis of gene expression (SAGE) is a method that allows the simultaneous
and quantitative analysis of a large number of gene transcripts, without the need
of providing an individual hybridization probe for each transcript. First, a short
sequence tag (about 10-14 bp) is generated that contains sufficient information to
uniquely identify a transcript, provided that the tag is obtained from a unique position
within each transcript. Then, many transcripts are linked together to form long serial
molecules, that can be sequenced, revealing the identity of the multiple tags simultaneously.
The expression pattern of any population of transcripts can be quantitatively evaluated
by determining the abundance of individual tags, and identifying the gene corresponding
to each tag. For more details see,
e.g. Velculescu et al., Science 270:484-487 (1995); and
Velculescu et al., Cell 88:243-51 (1997).
6. MassARRAY Technology
[0213] The MassARRAY (Sequenom, San Diego, Calif.) technology is an automated, high-throughput
method of gene expression analysis using mass spectrometry (MS) for detection. According
to this method, following the isolation of RNA, reverse transcription and PCR amplification,
the cDNAs are subjected to primer extension. The cDNA-derived primer extension products
are purified, and dispensed on a chip array that is pre- loaded with the components
needed for MALTI-TOF MS sample preparation. The various cDNAs present in the reaction
are quantitated by analyzing the peak areas in the mass spectrum obtained.
7. Immunohistochemistry
[0214] Immunohistochemistry ("IHC) methods are also suitable for detecting the expression
levels of the biomarkers of the present invention. Immunohistochemical staining of
tissue sections has been shown to be a reliable method of assessing or detecting presence
of proteins in a sample. Immunohistochemistry techniques utilize an antibody to probe
and visualize cellular antigens in situ, generally by chromogenic or fluorescent methods.
Thus, antibodies or antisera, preferably polyclonal antisera, and most preferably
monoclonal antibodies specific for each marker are used to detect expression. As discussed
in greater detail below, the antibodies can be detected by direct labeling of the
antibodies themselves, for example, with radioactive labels, fluorescent labels, hapten
labels such as, biotin, or an enzyme such as horse radish peroxidase or alkaline phosphatase.
Alternatively, unlabeled primary antibody is used in conjunction with a labeled secondary
antibody, comprising antisera, polyclonal antisera or a monoclonal antibody specific
for the primary antibody. Immunohistochemistry protocols and kits are well known in
the art and are commercially available.
[0215] Two general methods of IHC are available; direct and indirect assays. According to
the first assay, binding of antibody to the target antigen is determined directly.
This direct assay uses a labeled reagent, such as a fluorescent tag or an enzyme-labeled
primary antibody, which can be visualized without further antibody interaction. In
a typical indirect assay, unconjugated primary antibody binds to the antigen and then
a labeled secondary antibody binds to the primary antibody. Where the secondary antibody
is conjugated to an enzymatic label, a chromagenic or fluorogenic substrate is added
to provide visualization of the antigen. Signal amplification occurs because several
secondary antibodies may react with different epitopes on the primary antibody.
[0216] The primary and/or secondary antibody used for immunohistochemistry typically will
be labeled with a detectable moiety. Numerous labels are available which can be generally
grouped into the following categories:
- (a) Radioisotopes, such as 35S, 14C, 125I, 3H, and 131I. The antibody can be labeled with the radioisotope using the techniques described
in Current Protocols in Immunology, Volumes 1 and 2, Coligen et al., Ed. Wiley-Interscience,
New York, N.Y., Pubs. (1991) for example and radioactivity can be measured using scintillation counting.
- (b) Colloidal gold particles.
- (c) Fluorescent labels including, but are not limited to, rare earth chelates (europium
chelates), Texas Red, rhodamine, fluorescein, dansyl, Lissamine, umbelliferone, phycocrytherin,
phycocyanin, or commercially available fluorophores such SPECTRUM ORANGE® and SPECTRUM
GREEN® and/or derivatives of any one or more of the above. The fluorescent labels
can be conjugated to the antibody using the techniques disclosed in Current Protocols
in Immunology, supra, for example. Fluorescence can be quantified using a fluorimeter.
- (d) Various enzyme-substrate labels are available and U.S. Pat. No. 4,275,149 provides a review of some of these. The enzyme generally catalyzes a chemical alteration
of the chromogenic substrate that can be measured using various techniques. For example,
the enzyme may catalyze a color change in a substrate, which can be measured spectrophotometrically.
Alternatively, the enzyme may alter the fluorescence or chemiluminescence of the substrate.
Techniques for quantifying a change in fluorescence are described above. The chemiluminescent
substrate becomes electronically excited by a chemical reaction and may then emit
light which can be measured (using a chemiluminometer, for example) or donates energy
to a fluorescent acceptor. Examples of enzymatic labels include luciferases (e.g.,
firefly luciferase and bacterial luciferase; U.S. Pat. No. 4,737,456), luciferin, 2,3-dihydrophthalazinediones, malate dehydrogenase, urease, peroxidase
such as horseradish peroxidase (HRPO), alkaline phosphatase, β-galactosidase, glucoamylase,
lysozyme, saccharide oxidases (e.g., glucose oxidase, galactose oxidase, and glucose-6-phosphate
dehydrogenase), heterocyclic oxidases (such as uricase and xanthine oxidase), lactoperoxidase,
microperoxidase, and the like. Techniques for conjugating enzymes to antibodies are
described in O'Sullivan et al. Methods for the Preparation of Enzyme-Antibody Conjugates for use
in Enzyme Immunoassay, in Methods in Enzym. (ed J. Langone & H. Van Vunakis), Academic
press, New York, 73:147-166 (1981).
[0217] Examples of enzyme-substrate combinations include, for example:
- (i) Horseradish peroxidase (HRPO) with hydrogen peroxidase as a substrate, wherein
the hydrogen peroxidase oxidizes a dye precursor [e.g., orthophenylene diamine (OPD)
or 3,3',5,5'-tetramethyl benzidine hydrochloride (TMB)]. 3,3-Diaminobenzidine (DAB)
may also be used to visualize the HRP-labeled antibody;
- (ii) alkaline phosphatase (AP) with para-Nitrophenyl phosphate as chromogenic substrate;
and
- (iii) β-D-galactosidase (β-D-Gal) with a chromogenic substrate (e.g., p-nitrophenyl-β-D-galactosidase)
or fluorogenic substrate (e.g., 4-methylumbelliferyl-β-D-galactosidase).
[0218] Numerous other enzyme-substrate combinations are available to those skilled in the
art. For a general review of these, see U.S. Pat. Nos.
4,275,149 and
4,318,980.
[0219] Sometimes, the label is indirectly conjugated with the antibody. The skilled artisan
will be aware of various techniques for achieving this. For example, the antibody
can be conjugated with biotin and any of the four broad categories of labels mentioned
above can be conjugated with avidin, or vice verse. Biotin binds selectively to avidin
and thus, the label can be conjugated with the antibody in this indirect manner. Alternatively,
to achieve indirect conjugation of the label with the antibody, the antibody is conjugated
with a small hapten and one of the different types of labels mentioned above is conjugated
with an anti-hapten antibody. Thus, indirect conjugation of the label with the antibody
can be achieved.
[0220] Aside from the sample preparation procedures discussed above, further treatment of
the tissue section prior to, during or following IHC may be desired. For example,
epitope retrieval methods, such as heating the tissue sample in citrate buffer may
be carried out [see, e.g.,
Leong et al. Appl. Immunohistochem. 4(3):201 (1996)].
[0221] Following an optional blocking step, the tissue section is exposed to primary antibody
for a sufficient period of time and under suitable conditions such that the primary
antibody binds to the target protein antigen in the tissue sample. Appropriate conditions
for achieving this can be determined by routine experimentation.
[0222] The extent of binding of antibody to the sample is determined by using any one of
the detectable labels discussed above. Preferably, the label is an enzymatic label
(e.g. HRPO) which catalyzes a chemical alteration of the chromogenic substrate such
as 3,3'-diaminobenzidine chromogen. Preferably the enzymatic label is conjugated to
antibody which binds specifically to the primary antibody (e.g. the primary antibody
is rabbit polyclonal antibody and secondary antibody is goat anti-rabbit antibody).
[0223] Specimens thus prepared maybe mounted and coverslipped. Slide evaluation is then
determined, e.g. using a microscope.
[0224] IHC may be combined with morphological staining, either prior to or thereafter. After
deparaffinization, the sections mounted on slides may be stained with a morphological
stain for evaluation. The morphological stain to be used provides for accurate morphological
evaluation of a tissue section. The section may be stained with one or more dyes each
of which distinctly stains different cellular components. In one embodiment, hematoxylin
is use for staining cellular nucleic of the slides. Hematoxylin is widely available.
An example of a suitable hematoxylin is Hematoxylin II (Ventana). When lighter blue
nuclei are desired, a bluing reagent may be used following hematoxylin staining. One
of skill in the art will appreciate that staining may be optimized for a given tissue
by increasing or decreasing the length of time the slides remain in the dye.
[0225] Automated systems for slide preparation and IHC processing are available commercially.
The Ventana® BenchMark XT system is an example of such an automated system.
[0226] After staining, the tissue section may be analyzed by standard techniques of microscopy.
Generally, a pathologist or the like assesses the tissue for the presence of abnormal
or normal cells or a specific cell type and provides the loci of the cell types of
interest. Thus, for example, a pathologist or the like would review the slides and
identify normal cells (such as normal lung cells) and abnormal cells (such as abnormal
or neoplastic lung cells). Any means of defining the loci of the cells of interest
may be used (e.g., coordinates on an X-Y axis).
[0227] Anti-c-met antibodies suitable for use in IHC are well known in the art, and include
SP-44 (Ventana), DL-21 (Upstate), ab27492 (Abcam), PA1-37483 (Pierce Antibodies).
One of ordinary skill understands that additional suitable anti-c-met antibodies may
be identified and characterized by comparing with c-met antibodies using the IHC protocol
disclosed herein, for example.
[0228] Control cell pellets with various staining intensities may be utilized as controls
for IHC analysis as well as scoring controls. For example, H441 (strong c-met staining
intensity); A549 (moderate c-met staining intensity); H1703 (weak c-met staining intensity),
HEK-293 (293) (weak c-met staining intensity); and TOV-112D (negative c-met staining
intensity) or H1155 (negative c-met staining intensity). In some embodiments, Figures
1 and/or 2 herein may be referred to for exemplary c-met IHC scoring intensity. In
some embodiments, Figure 1 depicts exemplary 0, 1+, 2+ and 3+ c-met IHC scoring intensity,
for example in accordance with the scoring scheme of Table A below. In some embodiments,
Figure 2 depicts exemplary c-met IHC score 0, 1, 2, and 3, for example, in accordance
with the scoring scheme of Table A below.
[0229] A c-met immunohistochemistry protocol and scoring scheme is exemplified herein. C-met
staining intensity criteria may be evaluated according to Table A:
Table A
| IHC score |
Staining criteria |
| 0 |
samples with negative or equivocal staining, or < 50% tumor cells with weak (1+) or
combined weak (1+) & moderate (2+) staining |
| 1 |
50% or more tumor cells with weak (1+) or combined weak (1+) & moderate (2+) staining,
but less than 50% tumor cells with moderate (2+) or combined moderate (2+) & strong
(3+) staining |
| 2 |
50% or more tumor cells with moderate (2+) or combined moderate (2+) & strong (3+)
staining, but less than 50% tumor cells with strong (3+) staining |
| 3 |
50% or more tumor cells with strong (3+) staining |
[0230] In some embodiments, clinical "Met diagnostic positive" and "Met diagnostic negative"
categories are defined as follows:
Met diagnostic positive: IHC score 2 or 3 (as defined in Table A), and
Met diagnostic negative: IHC score 0 or 1 (as defined in Table A).
[0231] In some embodiments, high c-met biomarker associated is an IHC score of 2, an IHC
score of 3, or an IHC score of 2 or 3. In some embodiments, high c-met biomarker is
50% or more tumor cells with moderate c-met staining intensity, combined moderate/high
c-met staining intensity or high c-met staining intensity. In some embodiments, high-c-met
biomarker is 50% or more of tumor cells with moderate or high c-met staining intensity.
In some embodiments, at least 50 tumor cells are analyzed in a sample. In some embodiments,
at least 10, 20, 30, 40, 50, 60, or 70 or more tumor cells are analyzed in a sample.
In some embodiments, high c-met biomarker expression is met diagnostic positive (met
diagnostic positive clinical status) as defined in accordance with Table A herein.
[0232] In some embodiments, low c-met biomarker is an IHC score of 0, an IHC score of 1
or an IHC score of 0 or 1. In some embodiments, low c-met biomarker is negative c-met
staining, less than 50% of tumor cells with weak or combined weak and moderate c-met
staining intensity, or 50% or more tumor cells with weak or combined weak and moderate
c-met staining intensity but less than 50% tumor cells with moderate or combined moderate
and strong c-met staining intensity. In some embodiments, at least 10, 20, 30, 40,
50, 60, or 70 or more tumor cells are analyzed in a sample. In some embodiments, low
c-met biomarker expression is met diagnostic negative (met diagnostic negative clinical
status) as defined in accordance with Table A herein.
8. Proteomics
[0233] The term "proteome" is defined as the totality of the proteins present in a sample
(e.g. tissue, organism, or cell culture) at a certain point of time. Proteomics includes,
among other things, study of the global changes of protein expression in a sample
(also referred to as "expression proteomics"). Proteomics typically includes the following
steps: (1) separation of individual proteins in a sample by 2-D gel electrophoresis
(2-D PAGE); (2) identification of the individual proteins recovered from the gel,
e.g. my mass spectrometry or N-terminal sequencing, and (3) analysis of the data using
bioinformatics. Proteomics methods are valuable supplements to other methods of gene
expression profiling, and can be used, alone or in combination with other methods,
to detect the products of the prognostic markers of the present invention.
9. Gene amplification
[0234] Detecting amplification of the c-met gene is achieved using certain techniques known
to those skilled in the art. For example, comparative genome hybridization may be
used to produce a map of DNA sequence copy number as a function of chromosomal location.
See, e.g.,
Kallioniemi ct al. (1992) Science 258:818-821. Amplification of the c-mct gene may also be detected, e.g., by Southern hybridization
using a probe specific for the c-met gene or by real-time quantitative PCR.
[0235] In certain embodiments, detecting amplification of the c-met gene is achieved by
directly assessing the copy number of the c-met gene, for example, by using a probe
that hybridizes to the c-met gene. For example, a FISH assay may be performed. In
certain embodiments, detecting amplification of the c-met gene is achieved by indirectly
assessing the copy number of the c-met gene, for example, by assessing the copy number
of a chromosomal region that lies outside the c-met gene but is co-amplified with
the c-met gene. Biomarker expression may also be evaluated using an
in vivo diagnostic assay,
e.g. by administering a molecule (such as an antibody) which binds the molecule to be
detected and is tagged with a detectable label (
e.g. a radioactive isotope) and externally scanning the patient for localization of the
label.
IV. THERAPEUTIC METHODS
[0236] In one aspect, the invention provides a method for treating a patient with cancer,
comprising administering a therapeutically effective amount of a c-met antagonist
to the patient if the patient has been found to have a high (elevated) amount of c-met
biomarker.
[0237] The invention also concerns a method for treating a patient with NSCLC comprising
administering to the patient a therapeutically effective amount of a c-met antagonist
(e.g., an anti-c-met antibody e.g. MetMAb), if the patient has been found to have
an high amount of c-met biomarker (for example, if the patient's cancer expresses
high c-met biomarker, for example, as determined using IHC). In some embodiments,
NSCLC is squamous cell carcinoma. In some embodiments, NSCLC is adenocarcinoma. In
some embodiments, the NSCLC is second-line or third-line locally advanced or metastatic
NSCLC. In some embodiments, the NSCLC is locally advanced or metastatic NSCLC after
failure of at least one prior chemotherapy regimen. Methods for determining c-met
expression using IHC are discussed and exemplified herein. In some embodiments, the
patient's cancer has been shown to expresses high c-met with an IHC score 2, an IHC
score of 3, or an IHC score of at least 2 (2 or 3). In some embodiments, the patient's
cancer (a sample from the patient's cancer) has been shown to contain 50% or more
tumor cells with moderate c-met staining intensity, combined moderate/high c-met staining
intensity or high c-met staining intensity. In some embodiments, high-c-met biomarker
is 50% or more of tumor cells with moderate or high c-met staining intensity. In some
embodiments, criteria disclosed herein are used to score c-met biomarker status as
high or low.
[0238] Moreover, the invention provides a method for treating a patient with NSCLC comprising
administering to the patient a therapeutically effective amount of a combination of
a c-met antagonist (such as a anti-c-met antibody, such as MetMAb) and an EGRF antagonist
(such as erlotinib), if the patient has been found to have an high amount of c-met
biomarker. The patient treated herein desirably will benefit from (or be more likely
to exhibit) greater progression free survival (PFS) and overall survival (OS) relative
to a patient who has a reduced amount of the c-met biomarker. Exemplary EGFR antagonists
are described herein. In some embodiments, the NSCLC is locally advanced or metastatic
NSCLC after failure of at least one prior chemotherapy regimen.
[0239] The invention additionally concerns a method for treating a patient with cancer (such
as NSCLC) comprising administering to the patient a therapeutically effective amount
of a cancer other than a c-met antagonist, if the patient has been found to have a
reduced amount of c-met biomarker (for example, if the patient's cancer expresses
reduced c-met biomarker, for example, as determined by IHC). In some embodiments,
the patient's cancer does not detectably express c-met or expresses c-met with an
IHC score of 0, an IHC score of 1, or an IHC score of 0 or 1. In some embodiments,
criteria disclosed herein are used to score c-met biomarker status as negative. In
some embodiments, the patient's cancer (a sample from the patient's cancer) has been
shown to contain negative c-met staining, less than 50% of tumor cells with weak or
combined weak and moderate c-met staining intensity, or 50% or more tumor cells with
weak or combined weak and moderate c-met staining intensity but less than 50% tumor
cells with moderate or combined moderate and strong c-met staining intensity.
[0240] Cancer medicaments of the invention can be used either alone or in combination with
other cancer medicaments. For instance, an anti-c-met antibody (for example, MetMAb)
may be administered at a dose of about 15 mg/kg every three weeks, or at a dose of
about 10 mg/kg every two weeks.
[0241] For instance, a c-met antibody may be co-administered with at least one additional
therapeutic agent, e.g. with a chemotherapeutic agent, with other c-met antagonists
(such as other c-met antibodies), with an EGFR antagonist (such as erlotinib), or
with an anti-VEGF antibody (such a bevacizumab). A c-met antibody may be co-administered
with an additional c-met antagonist. Such combination therapies noted above encompass
combined administration (where two or more therapeutic agents are included in the
same or separate formulations), and separate administration, in which case, administration
of a first medicament can occur prior to, simultaneously, and/or following, administration
of a second medicament. In one embodiment, an anti-c-met antibody (such as MetMAb)
at a dose of about 15 mg/kg every three weeks; is used in combination with erlotinib
(N-(3-ethynylphenyl)-6,7-bis(2-methoxyethoxy)-4-quinazolinamine) at a dose of 150
mg, each day of a three week cycle. In other embodiments, a c-met antagonist (e.g.,
anti-c-met antibody) is used in combination with an anti-VEGF antibody and chemotherapy
(e.g., a taxane). An exemplary protocol is administering to a triple-negative metastatic
breast cancer patient an anti-c-met antibody (e.g., MetMAb) administered at a dose
of 10 mg/kg on Day 1 and Day 15 of a 28-day cycle, anti-VEGF antibody (e.g., bevacizumab)
administered at a dose of 10 mg/kg on Day 1 and Day 15 of the 28-day cycle and paclitaxel
administered at a dose of 90 mg/m
2 by IV infusion on Day 1, Day 8, and Day 15 of the 28-day cycle. An exemplary protocol
is administering to a triple-negative metastatic breast cancer patient an anti-c-met
antibody (e.g., MetMAb) administered at a dose of 10 mg/kg on Day 1 and Day 15 of
a 28-day cycle, and paclitaxel administered at a dose of 90 mg/m
2 by IV infusion on Day 1, Day 8, and Day 15 of the 28-day cycle.
[0242] Cancer medicaments can also be used in combination with radiation therapy.
[0243] The medicament(s) herein can be administered by any suitable means, including parenteral,
intrapulmonary, and intranasal, and, if desired for local treatment, intralesional
administration. Parenteral infusions include intramuscular, intravenous, intraarterial,
intraperitoneal, or subcutaneous administration. Dosing can be by any suitable route,
e.g. by injections, such as intravenous or subcutaneous injections, depending in part
on whether the administration is brief or chronic. Various dosing schedules including
but not limited to single or multiple administrations over various time-points, bolus
administration, and pulse infusion are contemplated herein.
[0244] For the prevention or treatment of disease, the appropriate dosage of an antibody
of the invention (when used alone or in combination with one or more other additional
therapeutic agents) will depend on the type of disease to be treated, the type of
antibody, the severity and course of the disease, whether the antibody is administered
for preventive or therapeutic purposes, previous therapy, the patient's clinical history
and response to the antibody, and the discretion of the attending physician. The antibody
is suitably administered to the patient at one time or over a series of treatments.
One typical daily dosage might range from about 1 µg/kg to 100 mg/kg or more, depending
on the factors mentioned above. For repeated administrations over several days or
longer, depending on the condition, the treatment would generally be sustained until
a desired suppression of disease symptoms occurs. However, other dosage regimens may
be useful. The progress of this therapy is easily monitored by conventional techniques
and assays.
[0245] It is understood that any of the above formulations or therapeutic methods may be
carried out using an immunoconjugate of the invention in place of or in addition to
an antibody as the medicament.
[0246] In some embodiments, the patient did not receive more than two prior treatments for
Stage IIIB/IV. In some embodiments, the patient did not receive more than 30 days
of exposure to an investigational or marketed agent that can act by EGFR inhibition,
or a known EGFR-related toxicity resulting in dose modifications. EGFR inhibitors
include (but are not limited to) gefitinib, erlotinib, and cetuximab. In some embodiments,
the patient did not receive chemotherapy, biologic therapy, radiotherapy or investigational
drug within 28 days prior to randomization (except that optionally, kinase inhibitors
may be used within two weeks prior to randomization provided any drug related toxicity
was adequately resolved). In some embodiments, the patient is not a patient with untreated
and/or active (progressing or requiring anticonvulsants or corticosteroids for symptomatic
control) CNS metastasis. Other patient exclusion criteria are described in the Examples,
and the present inventions contemplate use of one or more of the exclusions described
therein. In some embodiments, a sample of the patient's cancer has been shown to have
wildtype EGFR. In some embodiments, a sample of the patient's cancer has not been
shown to have mutated EGFR.
V. ARTICLES OF MANUFACTURE
[0247] In another embodiment of the invention, an article of manufacture for use in treating
cancer (such as NSCLC or breast cancer) is provided. The article of manufacture comprises
a container and a label or package insert on or associated with the container. Suitable
containers include, for example, bottles, vials, syringes,
etc. The containers may be formed from a variety of materials such as glass or plastic.
The container holds or contains a composition comprising the cancer medicament as
the active agent and may have a sterile access port (for example the container may
be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic
injection needle).
[0248] The article of manufacture may further comprise a second container comprising a pharmaceutically-acceptable
diluent buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered
saline, Ringer's solution and dextrose solution. The article of manufacture may further
include other materials desirable from a commercial and user standpoint, including
other buffers, diluents, filters, needles, and syringes.
[0249] The article of manufacture of the present invention also includes information, for
example in the form of a package insert, indicating that the composition is used for
treating cancer based on expression level of the biomarker(s) herein. The insert or
label may take any form, such as paper or on electronic media such as a magnetically
recorded medium (e.g., floppy disk) or a CD-ROM. The label or insert may also include
other information concerning the pharmaceutical compositions and dosage forms in the
kit or article of manufacture.
[0250] According to one embodiment of the invention, an article of manufacture is provided
comprising, packaged together, a c-met antagonist (e.g., an anti-c-met antibody) in
a pharmaceutically acceptable carrier and a package insert indicating that the c-met
antagonist is for treating a patient with cancer (such as NSCLC) based on expression
of a c-met biomarker.
[0251] The invention also concerns a method for manufacturing an article of manufacture
comprising combining in a package a pharmaceutical composition comprising a c-met
antagonist (e.g., an anti-c-met antibody) and a package insert indicating that the
pharmaceutical composition is for treating a patient with cancer (such as NSCLC) based
on expression of a c-met biomarker.
[0252] The article of manufacture may further comprise an additional container comprising
a pharmaceutically acceptable diluent buffer, such as bacteriostatic water for injection
(BWFI), phosphate-buffered saline, Ringer's solution, and/or dextrose solution. The
article of manufacture may further include other materials desirable from a commercial
and user standpoint, including other buffers, diluents, filters, needles, and syringes.
VI. DIAGNOSTIC KITS
[0253] The invention also concerns diagnostic kits useful for detecting any one or more
of the biomarker(s) identified herein. Accordingly, a diagnostic kit is provided which
comprises one or more reagents for determining expression of one or more of c-met,
k-ras, ALK and EGFR biomarker in a sample from a cancer patient. Optionally, the kit
further comprises instructions to use the kit to select a cancer medicament (e.g.
a c-met antagonist, such as an anti-c-met antibody) for treating the cancer patient
if the patient expresses the c-met biomarker at an high level. In another embodiment,
the instructions are to use the kit to select a cancer medicament other than c-met
antagonist (or other than an anti-c-met antibody) if the patient expresses the biomarker
at a reduced level.
VII. METHODS OF ADVERTISING
[0254] The invention herein also concerns a method for advertising a cancer medicament comprising
promoting, to a target audience, the use of the cancer medicament (e.g. anti-c-met
antibody) for treating a patient with cancer based on expression of c-met biomarker.
[0255] Advertising is generally paid communication through a non-personal medium in which
the sponsor is identified and the message is controlled. Advertising for purposes
herein includes publicity, public relations, product placement, sponsorship, underwriting,
and sales promotion. This term also includes sponsored informational public notices
appearing in any of the print communications media designed to appeal to a mass audience
to persuade, inform, promote, motivate, or otherwise modify behavior toward a favorable
pattern of purchasing, supporting, or approving the invention herein.
[0256] The advertising and promotion of the diagnostic method herein may be accomplished
by any means. Examples of advertising media used to deliver these messages include
television, radio, movies, magazines, newspapers, the internet, and billboards, including
commercials, which are messages appearing in the broadcast media. Advertisements also
include those on the seats of grocery carts, on the walls of an airport walkway, and
on the sides of buses, or heard in telephone hold messages or in-store PA systems,
or anywhere a visual or audible communication can be placed.
[0257] More specific examples of promotion or advertising means include television, radio,
movies, the internet such as webcasts and webinars, interactive computer networks
intended to reach simultaneous users, fixed or electronic billboards and other public
signs, posters, traditional or electronic literature such as magazines and newspapers,
other media outlets, presentations or individual contacts by,
e.g., e-mail, phone, instant message, postal, courier, mass, or carrier mail, in-person
visits, etc.
[0258] The type of advertising used will depend on many factors, for example, on the nature
of the target audience to be reached, e.g., hospitals, insurance companies, clinics,
doctors, nurses, and patients, as well as cost considerations and the relevant jurisdictional
laws and regulations governing advertising of medicaments and diagnostics. The advertising
maybe individualized or customized based on user characterizations defined by service
interaction and/or other data such as user demographics and geographical location.
EXAMPLES
Materials and Methods
[0259] Samples: Pretreatment patient samples were analyzed from a blind, Phase II, randomized, multicenter
trial (further described below) designed to evaluate preliminary activity and safety
of treatment with MetMAb plus erlotinib versus erlotinib plus placebo in NSCLC. Submission
of either a formalin-fixed paraffin-embedded tumor specimens or unstained paraffin
slides (15 slides) of representative tumor was required for all patients enrolled
into the study.
[0260] Immunohistochemistry (IHC): Formalin-fixed, paraffin-embedded tissue sections were deparaffinized prior to antigen
retrieval, blocking and incubation with primary anti-c-Met antibodies. Following incubation
with secondary antibody and enzymatic color development, sections were counterstained
and dehydrated in series of alcohols and xylenes before coverslipping.
[0261] The following protocol was used for IHC. The Ventana Benchmark XT system was used
to perform c-met IHC staining using the following reagents and materials:
Primary antibody: Ventana anti-Total cMET (SP44) Rabbit Monoclonal Primary Antibody
(cat# M3444.R)
Specimen Type: Formalin-fixed paraffin embedded (FFPE) samples and control cell pellets
of varying staining intensities
Procedure Species: Human
Instrument: BenchMark XT
Epitope Recovery Conditions: Cell Conditioning 1 (CC1, Ventana, cat # 950-124)
Primary Antibody Conditions: 10 ug/ml /16 Min at 37C
Diluent: Ventana antibody dilution buffer (Tris HCl buffer, cat# 95119)
Naive Antibody for negative control: Naive Rabbit IgG at 3 ug/ml (Ventana Confirm
negative control rabbit IgG , cat# 760-1029)
Detection: Ultraview Universal DAB Detection kit (Benchmark Reagent, polymer system,
Ventana cat # 760-500) used according to manufacturer's instructions.
Counterstain: Ventana Hematoxylin II (cat # 790-2208)/ with Bluing reagent (Cat #
760-2037)
[0262] The Benchmark XT Protocol was as follows:
- 1. paraffin (Selected)
- 2. Deparaffinization (Selected)
- 3. Cell Conditioning (Selected)
- 4. Conditioner #1 (Selected)
- 5. Mild CC1 (Selected)
- 6. Standard CC1(Selected)
- 7. Ab Incubation Temperatures (Selected)
- 8. 37C Ab Inc. (Selected)
- 9. Titration (Selected)
- 10. Hand Apply (Primary Antibody), and Incubate for (0Hr 16 Min)
- 11. Countstain (Selected)
- 12. Apply One Drop of (Hematoxylin II) (Countstain), Apply Coverslip, and Incubate
for (4 Minutes)
- 13. Post Countstain (Selected)
- 14. Apply One Drop of (BLUING REAGENT) (Post Countstain), Apply Coverslip, and Incubate
for (4 Minutes)
- 15. Wash slides in soap water to remove oil\
- 16. Rinse slides with water
- 17. Dehydrate slides through 95% Ethanol, 100% Ethanol to xylene (Leica autostainer
program #9)
- 18. Cover slip.
[0263] Scoring c-met expression by IHC: The presence or absence of c-met expression in tumor specimens was evaluated using
IHC. There was a wide dynamic range of c-met staining intensities in NSCLC, with tumor
cells staining with negative, weak, moderate, or strong intensity. In addition, c-met
expression within NSCLC tumor tissue was often heterogeneous; that is, tumor cells
exhibited different levels of met expression within a sample. Both the intensity of
IHC staining (negative, weak, moderate, or strong) and the proportion of tumor cells
that stained at different intensity levels were considered when evaluating c-met expression
by IHC. The criteria for defining met diagnostic positive tumors and met diagnostic
negative tumors were defined before study unblinding, as determined by IHC following
the scoring system below.
[0264] Tumor cells were scored for c-Met staining. In the majority of the cases, the staining
was primarily membranous with some cytoplasmic signals (M, c), however, predominant
cytoplasmic staining (C, m) was also observed in 5-10% samples. The staining was classified
as strong (3+), moderate (2+), weak (1+), equivocal (+/-) or negative (-) staining
intensity. Strong staining intensity was characterized by dark brown to black cytoplasm
and/or thickened, darkened membranes of similar intensity. Moderate staining intensity
was characterized by brown cytoplasm and/or membranes. The moderate staining lacked
the blackness seen in strong signal intensity and membranes were thinner. Weak signal
intensity was characterized by light brown cytoplasm. The weak signal lacked the rich
brown color seen in moderate staining intensity and membranes were thinner. Negative
or equivocal signal intensity was characterized by an absence of any detectable signal
or a pale gray or tan signal, rather than brown, and without evidence of enhanced
membrane staining.
[0265] In addition to evaluating staining intensity, percentages of various staining intensities/patterns
were visually estimated in the samples with heterogeneous signals.
[0266] The following control cell pellets with various staining intensities were included
as controls for IHC analysis as well as scoring controls: H441 (+++ (strong) staining);
A549 (++ (moderate) staining); H1703 (+ (weak) staining); and TOV-112D (- (negative)
staining) or H1155 (- (negative) staining). For lung samples, bronchial epithelium
was also used as an internal control, as it exhibited moderate (2+) membranous staining.
Isotype control antibody was also used to determine the basal background staining
of testing samples. Positive control antibody, such as Ki-67, was used to evaluate
tissue quality. Figure 2 shows an example of NSCLC tissue samples with IHC scores
of 0, 1, 2, or 3, prepared according to the IHC protocol above. As shown in Figure
2, c-met staining signal may be distributed homogenously having a uniform level of
intensity throughout the neoplastic portions of the tumor, or distributed heterogeneously
having more than one intensity level. Staining may be heterogeneous, for example,
samples may have more than one intensity level. Figure 1 shows exemplary control cell
pellets prepared according to the IHC protocol above.
[0267] After evaluating IHC staining, an IHC score was reported based on analysis of at
least 50 tumor cells with the following scoring cutoffs:
*interchangeably termed "IHC clinical score" or "clinical score"
| |
IHC score* |
Staining criteria |
| Diagnostic negative |
0 |
samples with negative or equivocal staining, or < 50% tumor cells with weak (1+) or
combined weak (1+) & moderate (2+) staining |
| 1 |
50% or more tumor cells with weak (1+) or combined weak (1+) & moderate (2+) staining,
but less than 50% tumor cells with moderate (2+) or combined moderate (2+) & strong
(3+) staining |
| Diagnostic positive |
2 |
50% or more tumor cells with moderate (2+) or combined moderate (2+) & strong (3+)
staining, but less than 50% tumor cells with strong (3+) staining |
| 3 |
50% or more tumor cells with strong (3+) staining |
Vascular staining was documented, but not used for IHC score, partly due to lack of
sufficient vasculature in some biopsy samples.
[0268] Clinical "Met diagnostic positive" and "Met diagnostic negative" categories were
defined as follows:
Met diagnostic negative: IHC score 0 or 1
Met diagnostic positive: IHC score 2 or 3.
[0269] For clarity, it is noted that the present application uses the following terminology:
| IHC score |
Clinical diagnostic category |
| 0 or 1 |
Met diagnostic negative, interchangeably termed Met Dx-, Met low, Met-Low, Met Low |
| 2 or 3 |
Met diagnostic positive, interchangeably termed Met Dx+, Met high, Met-High, Met High |
In addition, in
US patent application No. 61/378,911, filed August 31, 2010, a related patent application to the present application, the terms "met positive"
and "met negative" were used to refer to IHC score 2 or 3, and IHC score 0 or 1, respectively.
Clinical trial
[0270] Lung cancer is the leading cause of cancer death globally: it kills more people than
breast, colon, kidney, liver, melanoma and prostate cancers combined. Each year 1.18
million people die as a result of the disease (
Parkin DM. CA Cancer J Clin (2005) 55:74-108). The majority of patients with lung cancer are diagnosed when the disease is at
an advanced stage and has spread to other parts of the body.
[0271] Non-small cell lung cancer (NSCLC) is the most common form of the disease, accounting
for approximately 85% of all cases. Only 7.5% of people diagnosed with advanced (stage
IV) NSCLC are expected to be alive after five years. NSCLC can be classified as being
an adenocarcinoma, squamous cell carcinoma or large cell carcinoma. Adenocarcinoma
is the most common form of NSCLC. There is growing evidence that the two major NSCLC
histologic subtypes, adenocarcinoma (accounting for approximately 40% of lung cancers)
and SCC (accounting for approximately 25% of lung cancer) exhibit unique biologic
properties resulting in differential responses to similar therapies. Pemtrexed, while
active in adenocarcinoma, has shown relatively lower efficacy in SCC (
Scagliotti et al, 2008, J Clin Oncol. 26(21):3543-51. Epub 2008 May 27). Treatment with bevacizumab in NSCLC patients with centrally located
SCC has resulted in increased bleeding risk (
Sandler et al 2006, N Engl J Med. 355(24):2542-50). Finally, SCC patients with metastatic disease historically have worse overall survival
compared with adenocarcinoma. Thus, a need to identify effective regimens for this
histologic subset remains.
[0272] The original protocol for this study was described, e.g., in
WO2010/045345; however, the study was later modified to add enrollment of 50 patients with squamous
cell histology as follows. Patients were randomized in a 1:1 ratio to one of the two
treatment arms: MetMAb + erlotinib versus erlotinib + placebo. Once 120 patients,
comprising the "overall" population were enrolled, eligibility was restricted to patients
with squamous cell carcinoma (SCC) histology to ensure that a total of approximately
80 patients with SCC were enrolled in the study. Randomization for the first 120 patients
comprising the "overall" population was stratified by smoking status, performance
status, and histology, and randomization for the next 50 SCC patients was to be stratified
by smoking status and performance status. During this study, patients and treating
individuals, including the investigators, were blinded to the treatment assignment
of study drug (MetMAb or placebo). A protocol-specific analysis of data from this
study obtained on or before June 8, 2010 (n = 128 patients) suggested that patients
whose tumors expressed lower levels of c-met did not derive benefit from MetMAb. On
the basis of these data, screening and enrolment of new patient into the study was
stopped and the trial was modified as follows:
- MetMAb was discontinued in patient who had c-met diagnostic-negative tumors, with
the exception of certain patients if in the judgment of the investigator, the patient
was deriving benefit from the study drug.
- Patients with c-met diagnostic tumors who discontinued MetMAb for reasons other than
disease progression could be allowed to continue receiving erlotinib monotherapy.
- Patient with c-met diagnostic negative tumors randomized to the placebo+erlotinib
arm who exhibited disease progression were only allowed to cross over to receive MetMAb
(in addition to continuing erlotinib) if fresh tissue biopsy was obtained at disease
progression and IHC results showed tumor was c-met diagnostic-positive.
- All other patient continued to receive treatment according to protocol.
[0273] The primary objective of the amended study was to evaluate progression-free survival
(PFS) of MetMAb plus Erlotinib, relative to Erlotinib plus placebo, in patients with
Met positive tumors (as determined by immunohistochemistry), in patients with squamous
cell histology, as well as all patients (i.e., including patients with Met negative
tumors).
[0274] The secondary objectives of this study were: (a) to evaluate progression free survival
(PFS) in patients with squamous cell histology; (b) to determine the overall RECIST
1.0 response rate and duration of response in patients with c-met positive tumors,
squamous cell histology, as well as overall patient population; (b) to characterize
the safety and tolerability of MetMAb plus Erlotinib in patients with NSCLC; and (c)
to evaluate minimum concentration (Cmin) and maximum concentration (Cmax) of both
MetMAb and erlotinib in patients with NSCLC.
[0275] Additional objectives of this study were to (a) to evaluate overall survival, in
patients with squamous cell histology, c-met positive tumors as well as in the overall
population; (b) to evaluate the FDG-PET response rate by treatment group and in patients
with c-met positive tumors, as well as overall; (c) to evaluate progression-free survival
(PFS) in FDG-PET responders versus non-responders, by treatment group and in Met positive
tumors, squamous cell histology, as well as in the overall population; (d) to evaluate
the relationship between Response Evaluation Criteria In Solid Tumors (RECIST) 1.0
response at first tumor assessment and PFS; (e) to evaluate the relationship between
response and changes in biomarkers (or baseline expression of) related to the HGF/Met
and/or EGFR signaling pathways (including, but not limited to IL8 and serum HGF);
(f) to evaluate potential mechanisms of resistance in patients who progress on study;
and (g) evaluate time to progression in patients with c-met positive tumors as well
as overall.
[0276] Study design. This study was a Phase II, double-blind, randomized, multicenter trial designed to
evaluate the preliminary activity and safety of treatment with MetMAb plus Erlotinib
versus Erlotinib plus placebo in second and third-line NSCLC. Approximately 120 histologically
unspecified patients from approximately 40 multinational sites were randomized in
a 1:1 ratio to one of the two treatment arms: MetMAb plus Erlotinib vs. Erlotinib
plus placebo. Once 120 patients, comprising the "overall" population were enrolled,
eligibility was restricted to patients with squamous cell carcinoma (SCC) histology
to ensure that a total of approximately 80 patients with SCC are enrolled in the study.
Randomization for the first 120 patients comprising the "overall" population was stratified
by smoking status (non-smokers and smokers who have quit more than 10 years ago versus
current smokers and smokers who have quit less than 10 years ago), performance status
and histology, and randomization for the next 50 SCC patients will be stratified by
smoking status and performance status. Treatment in each arm was continued until progression
of disease, unacceptable toxicity, or any other discontinuation criterion was met.
Upon disease progression, patients randomized to the Erlotinib plus placebo arm were
given the option to receive MetMAb (in addition to continuing Erlotinib), provided
they continue to meet eligibility criteria. Safety data collected from this cross-over
was summarized for hypothesis generating purposes. As noted above, a protocol-specific
analysis of data from this study obtained on or before June 8, 2010 (n = 128 patients)
suggested that patients whose tumors expressed lower levels of c-met did not derive
benefit from MetMAb. On the basis of these data, screening and enrollment of new patient
into the study was stopped and the trial was modified as noted above.
[0277] During the study, data on tumor measurement and survival status were collected for
evaluation of PFS, overall survival (OS) and overall response rate (ORR). CT scans
were obtained at baseline and for the first four cycles at an approximately every
6 week intervals (i.e., every two three-week cycles of MetMAb/placebo). After four
cycles, routine CT scans were performed approximately every 9 weeks (every 3 cycles
of MetMAb/placebo). FDG-PET imaging is obtained at baseline and at Day 10-14 of Cycle
1. During the course of this study, an Image Reading facility (IRF) evaluated FDG-PET
results and determined whether FDG-PET imaging should continue in all participating
sites or whether FDG-PET imaging should be confined to a few sites based on data received.
[0278] In some patients, exploratory serum and plasma samples were collected to determine
the effect of MetMAb plus Erlotinib on circulating levels of potential markers of
activity, including but not limited to IL-8 and HGF. Correlating these and other markers
with clinical outcomes assists in identifying predictive biomarkers, e.g., markers
in circulation that may reflect drug activity or response to therapy. Blood for serum
and plasma was drawn from consenting patients at pre-specified times and evaluated
for levels of these exploratory markers.
[0279] Expression of c-met and/or EGFR was determined in a pre-treatment sample of the tumor.
C-met and/or EGFR expression was determined by IHC and/or FISH analysis.
[0280] Because of the well-established survival benefit of Eastern Asians when treated with
EGFR-directed therapies, this study did not allow more than 20% of the evaluable study
population to be Eastern Asians.
[0281] Outcome measures. The primary outcome measure of this study was progression free survival (PFS) defined
by the Response Evaluation Criteria In Solid Tumors (RECIST)) 1.0 or death from any
cause within thirty days of the last treatment.
[0282] The secondary outcome measures for this study were as follows:
- (a) overall response (OR) (partial response plus complete response) as determined
using RECIST 1.0 in Met positive tumors and overall; and
- (b) duration of OR.
[0283] Exploratory outcome measures included the following:
- (a) FDG-PET response rates, as determined based on the definitions of the European
Organization for Research of Cancer (EORTC);
- (b) Incidence, nature and severity of adverse events and serious adverse events, and
changes in vital signs, physical findings, and clinical laboratory results during
and following study drug administration will be monitored; and
- (c) Overall survival (time from randomization until death from any cause within 30
days of the last study treatment).
[0284] Primary and secondary outcome measures will be assessed in patients with c-met positive
tumors, in SCC patients, and in the "overall" population.
[0285] Serum samples will be collected for analysis of MetMAb and erlotinib pharmacokinetics
and pharmacodynamics.
[0286] Patient selection criteria. Adult patients were eligible to participate in this study if they have inoperable
locally advanced or metastatic (Stage IIIb/IV) NSCLC (e.g., as determined by histological
studies) and have received at least one, but no more than two prior regimens for Stage
IIIb/IV NSCLC disease. Availability at the site of a representative formalin-fixed
paraffin-embedded tumor specimen that enabled the definitive diagnosis of NSCLC with
adequate viable tumor cells in a tissue block (preferred) or 15 unstained serial slides,
accompanied by an associated pathology report, was required prior to randomization.
Cytological samples or fine-needle aspiration samples were not acceptable. The patient
may still have be eligible if the patient provided at least greater than or equal
to 5 unstained serial slides or was willing to consent to and undergo a pre-treatment
core or excisional biopsy of the tumor. Cytological or fine-needle aspiration samples
were not acceptable.
[0287] In this study, cancer staging followed the American Joint Committee on Cancer's AJCC
Cancer Staging Manual, 6
th edition. Patients who received neo-adjuvant and/or adjuvant therapy for Stage I-IIIa
disease prior to their first-line regiment (for Stage IIIb/IV) were eligible for study
participation, provided they also received first-line therapy for Stage IIIb/IV disease.
In some embodiments, at least one of the chemotherapy containing regimens (for any
stage) was platinum-based. Patients must have had measurable disease as determined
by RECIST. In some embodiments, patients had at least one measurable lesion on a pre-treatment
FDG-PET scan that is also a target lesion on CT according to RECIST. In some embodiments,
patients provided a pre-treatment tumor specimen, and possessed at least one measurable
lesion on a pre-treatment FDG-PET scan that is also a target lesion on CT according
to RESIST.
[0288] In some embodiments, excluded subjects were subjects who had more than two prior
treatments for Stage IIIB/IV. In some embodiments, excluded subjects included subjects
with more than 30 days of exposure to an investigational or marketed agent that can
act by EGFR inhibition, or a known EGFR-related toxicity resulting in dose modifications.
EGFR inhibitors include (but are not limited to) gefitinib, erlotinib, and cetuximab.
In some embodiments, excluded subjects included subjects who received chemotherapy,
biologic therapy, radiotherapy or investigational drug within 28 days prior to randomization
(except that kinase inhibitors may be used within two weeks prior to randomization
provided any drug related toxicity was adequately resolved), or subjects with untreated
and/or active (progressing or requiring anticonvulsants or corticosteroids for symptomatic
control) CNS metastasis. In some embodiments, subjects with history of brain metastasis
were eligible for study participation, as long as they met the following criteria:
(a) measurable disease outside the CNS, as defined by RECIST; (b) no radiographic
evidence of interim progression between the completion of CNS-directed therapy and
the screening radiographic study; (c) CNS-directed treatment which may include neurosurgery
or stereotactic radiosurgery; (d) the screening of CNS radiographic study was ≥ 4
weeks since completion of radiotherapy and ≥ 2 weeks since the discontinuation of
corticosteroids and anticonvulsants; (e) radiotherapy and stereotactic radiosurgery
was completed ≥ 4 weeks prior to Day 1; and (f) neurosurgery was completed ≥ 24 weeks
prior to Day 1, and brain biopsy was completed ≥ 12 weeks prior to Day 1.
[0289] In some embodiment, excluded subject also included subjects with history of serious
systemic disease, including myocardial infarction within the last 6 months prior to
randomization, uncontrolled hypertension (persistent blood pressure > 150/100 mmHg
on antihypertensives), unstable angina, New York Heart Association (NYHA) Grade II
or greater congestive heart failure, unstable symptomatic arrhythmia requiring medication
(patients with chronic atrial arrhythmia, i.e., atrial fibrillation or paroxysmal
supraventricular tachycardia are eligible), or Grade II or greater peripheral vascular
disease; uncontrolled diabetes as evidenced by fasting serum glucose level > 200mg/dL;
major surgical procedure or significant traumatic injury within 28 days prior to randomization;
anticipation of need for a major surgical procedure during the course of the study;
local palliative radiotherapy within 7 or 14 days prior to randomization or persistent
adverse effects from radiotherapy that have not been resolved to Grade II or less
prior to randomization; inability to take oral medication or requirement for IV alimentation
or total parenteral nutrition with lipids, or prior surgical procedures affecting
gastrointestinal absorption. In some embodiments, excluded subjects included subjects
having any of the following uncorrected abnormal hematologic values (within 2 weeks
prior to randomization): ANC < 1,500 cells/µL, Platelet count < 100,000 cells/µL,
Hemoglobin < 9.0 g/dL, following RBC transfusion, Other baseline laboratory values
(within 2 weeks prior to randomization), Serum bilirubin > 1.5xULN, Serum creatinine
> 1.5xULN, Uncontrolled hypercalcemia (> 11.5 mg/dL or > 1.5 ionized calcium). In
some embodiments, excluded subject included subjects having uncontrolled diabetes
and subjects having symptomatic hypercalcemia requiring continued use of bisphosphonate
therapy.
[0290] In some embodiments, excluded subjects included pregnant or breast-feeding women;
subjects having other malignancies that have undergone a putative surgical or radiotherapy
cure (e.g., intraepithelial carcinoma of the cervix uteri, localized prostate cancer
post prostatectomy, or basal/squamous cell carcinoma of the skin) within 5 years prior
to randomization could be discussed with the medical monitor; or evidence of confusion
or disorientation, or history of major psychiatric illness. See also additional exclusions
on the label of erlotinib.
[0291] Statistical methods and efficacy analysis. Primary and secondary efficacy analyses included all randomized patients, with patients
allocated to the treatment arm to which they were randomized. Safety analyses included
all randomized patients who received at least one dose of study treatment, with patients
allocated to the treatment arm associated with the regimen actually received. Demographic
and baseline characteristics (e.g. age and sex) were summarized using means, standard
deviations, medians, and ranges for continuous variables and proportions for categorical
variables, as appropriate. Summaries were presented by overall patient population
and by treatment arm. The baselines value of any variable were defined as the last
available value prior to the first administration of study treatment.
[0292] Kaplan-Meier methodology was used to estimate the median PFS for each treatment arm.
The stratification factors were determined by the computer readable form (CRF) data,
not by data collected by the interactive voice readable system at the time of randomization
unless the CRF data was missing. Estimation of the hazard ration (i.e., the magnitude
of the treatment effect and the 95% confidence interval) was determined using a stratified
Cox regression model with an indicator variable for MetMAb treatment. The same analysis
methods as those described for PFS in "overall" population patients were applied to
patients with met positive tumors and to patients with SCC histology. All deaths from
any cause within 30 days of the last treatment were included as PFS events. Objective
response was defined as a complete or partial response determined on two consecutive
occasions greater than or equal to four weeks apart. Patients without a post-baseline
tumor assessment were considered non-responders. An estimate of the objective response
rate and 95% confidence interval (Blyth-Still-Casella) was calculated for each treatment
arm. Confidence intervals for the difference in tumor response rate (Satnes and Snell
1980; Berger and Boos 1994) were calculated. For patients with an objective response,
duration of objective response was defined as the time from the initial response to
disease progression or death from any cause within 30 days of the last treatment.
Methods for handling censoring and for analysis were the same as described for PFS.
All secondary efficacy endpoints were assessed for patients with met positive tumors,
patients with SCC histology and by "overall" patient population.
[0293] Trial drugs. MetMAb is a known recombinant, humanized, monovalent monoclonal antibody directed
against c-met. MetMAb is supplied as a sterile liquid in a single-use 15-cc vial.
Each vial contains 600mg of MetMAb in 10ml at a concentration of 60mg/ml in 10mM histidine
acetate, 120nM trehalose, 0.02% polysorbate 20, pH 5.4. MetMAb vials are refrigerated
at 2C-8C and remain refrigerated until just prior to use. MetMAb is administered intravenously,
after dilution in normal saline (0.9%).
[0294] Erlotinib (TARCEVA®) is provided as a conventional, immediate-release tablet containing
erlotinib as the hydrochloride salt. In addition to the active ingredient, erlotinib,
tablets contain lactose (hydrous), microcrystalline cellulose, sodium starch glycolate,
sodium lauryl sulfate and magnesium stearate. Tablets containing 25mg, 100mg and 150mg
of Erlotinib are available.
[0295] Placebo consisted of 250 cc 0.9% NSS (Saline IV solution, 0.9%).
[0296] Study treatment. The dose of MetMAb was 15 mg/kg intravenously on Day 1 of a 3-week cycle. The weight
at screening was used to determine the actual dose of MetMAb. The dose of erlotinib
was 150 mg by mouth each day of a 3 -week cycle. Dosage level for erlotinib may have
been reduced to 100 mg (first reduction) or 50 mg (second reduction) for toxicity
likely attributable to erlotinib (e.g., rash, diarrhea).
[0297] MET and EGFR copy number: MET and
EGFR gene copy numbers were evaluated by fluorescent in situ hybridization (FISH). Greater
than or equal to 5 copies of MET/cell were designated as FISH positive (see,
Cappuzzo et al, J Clin Oncol (2009) 27:1667-9). True MET amplification was defined as tight gene cluster of greater than or equal
to 15 copies of MET in greater than or equal to 10% of tumor cells or a MET/CEP7 ratio
of greater than or equal to 2. For experiments in which both MET and EGFR copy number
were evaluated, tumors were considered MET and EGFR FISH positive based on a scoring
criterion used in multiple clinical studies (see, e.g.,
Varella-Garcia et al, J Clin Pathol (2009) 62, 970-7;
Capuzzo et al, JNCI (2005); 97:643-55.): FISH positive: gene amplification or high polysomy, FISH negative: low polysomy,
trisomy or disomy, Gene amplification: tight gene clusters or ≥15 copies of MET in
≥10% of tumor cells or MET to CEP7 ratio of ≥2, High polysomy: ≥ 4 copies of MET in
≥ 40% of tumor cells.
[0298] EGFR, KRAS and MET genotyping: DNA was isolated from macro-dissected tumor tissue slides.
EGFR and
KRAS mutations were evaluated using the DxS genotyping kits,
MET exon 14 variants were evaluated by DHPLC (Transgenomics Inc, Omaha NE) and a
MET N275S polymorphism was evaluated by pyrosequencing.
[0299] mRNA profiling:
MET, HGF, EGFR, AREG, and EREG mRNA expression was evaluated on RNA extracted from macro-dissected tumor tissue
slides using the Fluidigm platform. Transcript levels were normalized to the mean
of two reference genes that are stably expressed in lung tissue and results are expressed
as normalized expression values (2
ΔCt).
[0300] Plasma HGF: HGF levels in plasma collected prior to treatment were evaluated by capture ELISA.
Results of analysis based on data cut-off date of on or before June 8, 2010
[0301] 128 patients with second or third line NSCLC were enrolled and randomized at 25 global
sites from March 2009 to March 2010 to: (a) MetMAb (15mg/kg IV q3wks) plus erlotinib
treatment (interchangeably termed "ME") (n=64) or (b) placebo plus erlotinib treatment
(interchangeably termed "PE") (n=64). The data cut-off date used in this analysis
was on or before June 8, 2010.
[0302] Patient disposition is shown in Table 1.
Table 1: Patient Disposition
| n(%) |
Erlotinib +Placebo |
Erlotinib +MetMAb |
Total |
| |
(n=64) |
(n=64) |
(n=128) |
| Discontinued Blinded Treatment |
48 (75.0) |
49 (76.6) |
97 (75.8) |
| Disease progression |
39 (60.9) |
34 (53.1) |
73 (57.0) |
| Adverse events |
2 (3.1) |
7 (10.9) |
9 (7.0) |
| Deaths |
4 (6.3) |
2 (3.1) |
6 (4.7) |
| Other |
3 (4.7) |
6 (9.4) |
9 (7.0) |
[0303] Patient demographics are shown in Table 2.
Table 2: Patient Demographics
| |
Erlotinib+Placebo n=64 (%) |
Erlotinib+MetMAb n=64 (%) |
| Median age (range) |
62 (42-83) |
66 (30-83) |
| Sex: male, n (%) |
39 (60.9) |
36 (56.3) |
| Race: White, n (%) |
58 (90.6) |
56 (87.5) |
| ECOG: 0/1, n (%) |
62 (96.9) |
60 (93.8) |
| Non-squamous, n (%) |
48 (75) |
49 (76.6) |
| Squamous, n (%) |
16 (25) |
15 (23.4) |
| Never smoker, n (%) |
8 (12.5) |
10 (15.6) |
| Met high*, n (%) |
30 (50.8) |
35 (56.5) |
| Kras mutant**, n (%) |
13 (23.2) |
13 (23.2) |
| EGFR mutant**, n (%) |
6 (10.7) |
7 (12.5) |
* Of 121 patients with evaluable tissue samples
* Of 112 patients with evaluable tissue samples. |
Baseline characteristics were well-balanced in the overall (ITT) population including
prevalence of patients with Met high tumors (51%/56.5%; PE/ME), Kras mutation (23%/23%)
and EGFR mutation (11%/12.5%). Tissue was evaluable for Met IHC analysis in 121 patients
(95% of patients), and for EGFR and KRAS mutations in 112 patients.
[0304] Baseline characteristics by Met status are shown in Table 3.
Table 3: Baseline characteristics by Met status.
| |
Met High |
Met Low |
| |
(n=65) |
(n=56) |
| |
MetMAb+ Erlotinib (n=35) |
Placebo+ Erlotinib (n=30) |
MetMAb+ Erlotinib (n=27) |
Placebo+ Erlotinib (n=29) |
| Age (yr): |
|
|
|
|
| Median (range) |
66 (30 - 83) |
63 (44 - 82) |
66 (45-82) |
60 (42 - 83) |
| >= 65 yrs |
18 (51.4%) |
14 (46.7%) |
14 (51.9%) |
11 (37.9%) |
| Sex: |
|
|
|
|
| Male |
18 (51.4%) |
19 (63.3%) |
17 (63.0%) |
16 (55.2%) |
| Baseline ECOG: |
|
|
|
|
| 0/1 |
34 (97.1 %) |
28 (93.3%) |
24 (88.9%) |
29 (100%) |
| Histopathology: |
|
|
|
|
| Adenocarcinoma |
26 (73.3%) |
21 (70.0%) |
12 (44.4%) |
17 (58.6%) |
| Squamous |
5 (14.3%) |
4 (13.3%) |
10 (37.0%) |
10 (34.5%) |
| Smoking History: |
|
|
|
|
| Never smoker |
7 (20.0%) |
6 (20%) |
2 (7.4%) |
1 (3.4%) |
| Kras mutant * |
7 (22.6%) |
6 (23.1%) |
6 (24.0%) |
7 (25.0%) |
| EGFR mutant* |
7 (22.6%) |
2 (7.7%) |
0 |
4 (14.3%) |
| * Of 112 patients with evaluable tissue samples |
In this study, tissue was obtained from 100% of patients. 95% of patients had adequate
tissue for evaluation of Met by IDC. 54% of patients had "Met high" NSCLC.
[0305] Treatment with MetMAb and erlotinib provided a clinically meaningful benefit to patients
with Met high NSCLC (Figure 3). Both a PFS benefit (Hazard ratio (HR) 0.56; 95% CI
0.31, 1.02; p=0.05,) and an OS benefit (HR 0.55; 95% CI 0.25, 1.16; p=0.11) were observed
in the Met-high patients treated with MetMAb plus erlotinib. Early and sustained separation
of the curves was observed. The addition of MetMAb to erlotinib nearly doubled the
progression free survival and overall survival in patients with met high NSCLC, compared
to treatment with erlotinib + placebo (PFS in ME was 12.4 weeks, verses 6.4 weeks
in PE; OS in ME was 7.7 weeks verses 7.4 weeks in PE). 23 patients from the erlotinib
+ placebo arm crossed over to MetMAb and 12 of the 23 patients who crossed over the
ME had Met high biomarker expression.
[0306] Met Low NSCLC patients did not benefit from treatment with MetMAb + erlotinib (Figure
4). MetMAb increased the risk of progression and death in Met low NSCLC patient verses
treatment with erlotinib and placebo: both PFS (HR 2.01; 95% CI 1.04, 3.91; p=0.04)
and OS (HR 3.26; 95% CI 1.20, 8.80; p=0.01) were worse in the ME cohort. ∼70 percent
of Met low patients treated with MetMAb and erlotinib progressed by the first assessment
(CAT scan at week 6).
[0307] PFS and OS in the overall population (Figure 5). PFS and OS were not significantly
different in the MetMAb plus erlotinib and placebo plus erlotinib treatment arms in
the overall population. MetMAb plus erlotinib treatment did not show benefit in the
overall population relative to placebo plus erlotinib treatment. The HRs for PFS and
OS in the overall (interchangeably termed "intent to treat" or ITT) population were
1.09 (95% CI 0.71, 1.67; p=0.70) and 1.09 (95% CI 0.62, 1.91; p=0.76). Median PFS
and media OS were consistent with previously reported findings in similar disease
settings. 23 patients from the erlotinib + placebo arm crossed over to MetMAb+ erlotinib
treatment. Objective response rates were: Erlotinib + Placebo n=3 (4.7%), Erlotinib
+ MetMAb n=4 (6.3%).
[0308] PFS was examined by subgroups (Figure 6). Met IHC status 3 and 2 patients showed
benefit from MetMAb + erlotinib treatment, with status 3 patients showing greater
benefit. Met IHC status 0 and 1 patients did not benefit from MetMAb plus erlotinib
treatment. Status 0 patients did worse on MetMAb + erlotinib than status 1 patients.
Selective benefit of MetMAb + erlotinib treatment was not observed in other subgroups,
including: histology category (non-squamous verses squamous cell), tobacco history,
ECOGCC, EGFR mutation or Kras mutation.
[0309] Figure 9 shows subgroup analysis of PFS in Met High patients.
[0310] OS was also examined by subgroups (Figure 7). Similar to the PFS results, Met high
IHC status 3 and 2 patients showed benefit from MetMAb + erlotinib treatment, with
status 3 patients showing greater benefit. Met low IHC status 0 and 1 patients did
not benefit from MetMAb plus erlotinib treatment. Status 0 patients did worse on MetMAb
+ erlotinib than status 1 patients. Selective benefit of MetMAb + erlotinib treatment
was not observed in other subgroups, including: histology category (non-squamous verses
squamous cell), tobacco history, ECOGCC, EGFR mutation or Kras mutation.
[0311] Figure 10 shows subgroup analysis of OS in Met High patients. Figures 11 and 12 show
subgroup analysis of PFS and OS, respectively, in Met Low patients.
[0312] Overall survival was also analyzed in the Met high population excluding patients
with known EGFR mutations. The degree of benefit of MetMAb + erlotinib treatment (relative
to placebo + erlotinib) (OS HR =0.55, 95% CI 0.26, 1.20, p = 0.13) was approximately
equal to overall survival in the Met high population including patients with known
EGFR mutations Thus, the benefit from MetMAb + erlotinib in Met high patients was
not driven by EGFR mutation status.
[0313] Key prognostic variables by Met status are shown in Table 4.
Table 4: Key prognostic variables by Met status
| |
Met Positive (n=65) |
Met Negative (n=56) |
| |
Erlotinib + Placebo (n=30) |
Erlotinib +MetMAb (n=35) |
Erlotinib +Placebo (n=29) |
Erlotinib +MetMAb (n=27) |
| Histopathology (n=128) |
| Adenocarcinoma |
21 (70.0) |
26 (73.3) |
17 (58.6) |
12 (44.4) |
| Squamous |
4 (13.3) |
5 (14.3) |
10 (34.5) |
10 (37.0) |
| Mutational analyses (n=112) |
| Kras mutant |
6 (23.1) |
7 (22.6) |
7 (25.0) |
6 (24.0) |
| EGFR mutant |
2 (7.7) |
7 (22.6) |
4 (14.3) |
0 |
[0314] Met expression was prognostic for a worse outcome (Figure 8). In an analysis of the
erlotinib + placebo -treated patients, Met high patients had increased risk of progression
(HR = 1.73; median PFS of 6.4 weeks) and approximately double the risk of death (HR
= 2.52; median OS of 7.4 weeks) relative to Met low patients (median PFS 11.4 weeks;
median OS of 9.2 weeks). Thus, Met expression is a prognostic factor for progression
and survival in erlotinib-treated second- or third-line NSCLC patients: Met high patients
did worse when treated with erlotinib, while Met low patients did better when treated
with erlotinib.
[0315] Pattern of progression (growth of target verses new lesion) was comparable between
treatment groups and by met status (Table 5).
Table 5: Pattern of progression
| |
Met High |
Met Low |
| Erlotinib +Placebo |
Erlotinib +MetMAb |
Erlotinib +Placebo |
Erlotinib +MetMAb |
| # pts PD by RECIST |
n=21 |
n=17 |
n=15 |
n=15 |
| PD on target lesions |
13 (61.9) |
11 (64.7) |
10 (66.7) |
11 (73.3) |
| PD by new lesions |
12 (57.1) |
9 (52.9) |
6 (40.0) |
7 (46.7) |
Pattern of progression (growth of target verses new lesion) was comparable between
treatment groups and by Met status.
[0316] Efficacy analysis of ORR is shown in Table 6.
Table 6: Efficacy analysis of ORR.
| |
Erlotinib+Placebo |
Erlotinib+MetMAb |
| |
|
|
| Overall |
n=64 |
n=64 |
| |
|
|
| No. of patients with OR (%) |
|
|
| 3 (4.7) |
4 (6.3) |
| |
|
| 95% CI for ORR |
1.3-12.5 |
2.2-15 |
| Difference in ORR, % (95% CI) |
|
| 1.6 (-6.3-9.4) |
| |
| p-value |
1.0 |
| Met High |
n=30 |
n=35 |
| No. of patients with OR (%) |
1 (3.3) |
3 (8.6) |
| 95% CI for ORR |
0.2%-16.3 |
2.4-21.5 |
| Difference in ORR, % (95% CI) |
5.2 (-6.0-16.5) |
| p-value |
0.62 |
[0317] Exposure to treatment by Met status is shown in Table 7.
Table 7: Exposure to treatment by Met status
| |
High Met |
Low Met |
| |
Erlotinib |
Erlotinib |
Erlotinib |
Erlotinib |
| |
+Placebo (n=30) |
+MetMAb (n=35) |
+Placebo (n=29) |
+MetMAb (n=27) |
| MetMAb or Placebo |
| No. Cycles: median (range) |
2 (1-14) |
4 (1-18) |
4 (1-12) |
2 (1-8) |
| Erlotinib |
| No. Doses: median (range) |
49.5 (4-290) |
61 (14-338) |
85 (21-239) |
42 (1-152) |
| Patients requiring dose modification (%) |
8 (26.7) |
14 (40) |
7 (24.1) |
11 (40.7) |
[0318] Safety: Treatment with Erlotinib + MetMAb was well-tolerated. Table 8 shows all adverse
events, regardless of relationship, with reported frequency greater than 10% observed
in the study. With the exception of edema (predominantly Grade 1-2), overall toxicity
for Erlotinib + MetMAb was comparable to Erlotinib + Placebo.
Table 8: All adverse events
| |
Met High |
Met Low |
| n (%) |
Erlotinib +Placebo (n=30) |
Erlotinib +MetMAb (n=35) |
Erlotinib +Placebo (n=29) |
Erlotinib +MetMAb (n=27) |
| Total |
30 (100) |
35 (100) |
29 (100) |
26 (96.3) |
| Rash |
19 (63.3) |
21 (60.0) |
16 (52.2) |
15 (55.6) |
| Diarrhea |
13 (43.3) |
18 (51.4) |
13 (44.8) |
7 (25.9) |
| Fatigue |
12 (40.0) |
15 (42.9) |
10 (34.5) |
6 (22.2) |
| Decreased appetite |
10 (33.3) |
1 (28.6) |
5 (17.2) |
3 (11.1) |
| Nausea |
8 (26.7) |
1 (28.6) |
8 (27.6) |
9 (33.3) |
| Dyspnea |
8 (26.7) |
7 (20.0) |
4 (13.8) |
4 (14.8) |
| Cough |
6 (20.0) |
6 (17.1) |
5 (17.2) |
3 (11.1) |
| Dermititis acneform |
3 (10.0) |
5 (14.3) |
6 (20.7) |
5 (18.5) |
| Dry skin |
5 (16.7) |
5 (14.3) |
5 (17.2) |
2 (7.4) |
| Peripheral edema |
2 (6.7) |
7 (20) |
2 (6.9) |
5 (18.5) |
| Anemia |
5 (16.7) |
4 (11.4) |
3 (10.3) |
3 (11.1) |
[0319] Table 9 shows all grade 3-5 adverse events (frequency > 5%) observed in the study.
There were no grade 5 events. Rash, diarrhea, and fatigue were comparable between
treatment arms in both Met high and Met low subpopulations. The incidence of Grade
≥3 adverse events was similar in ME v. PE in the Met high group (54% v. 53%); however,
incidence of Grade ≥3 adverse events was higher in the ME arm in the Met low group
(52%vs 35% in the PE arm).
Table 9: Grade 3-5 adverse events
| |
Met high |
Met low |
| n (%) |
Erlotinib +Placebo (n=30) |
Erlotinib +MetMAb (n=35) |
Erlotinib +Placebo (n=29) |
Erlotinib +MetMAb (n=27) |
| Total |
16 (53.3) |
19 (54.3) |
10 (34.5) |
14 (51.9) |
| Rash |
1 (3.3) |
3 (8.6) |
1 (3.4) |
1 (3.7) |
| Diarrhea |
2 (6.7) |
4 (11.4) |
1 (3.4) |
1 (3.7) |
| Pneumonia |
0 |
1 (2.9) |
1 (3.4) |
4 (14.8) |
| Fatigue |
1 (3.3) |
3 (8.6) |
1 (3.4) |
2 (7.4) |
| Pulmonary embolism |
1 (3.3) |
2 (5.7) |
0 |
2 (7.4) |
[0320] A summary of safety is shown in Table 10.
Table 10: Summary of safety.
| |
Met High |
Met Low |
| n (%) |
Erlotinib +Placebo (n=30) |
Erlotinib +MetMAb (n=35) |
Erlotinib + Placebo (n=29) |
Erlotinib +MetMAb (n=27) |
| Any AEs |
30 (100) |
35 (100) |
29 (100) |
26 (96.3) |
| Grade ≥3 AEs |
16 (53.3) |
19 (54.3) |
10 (34.5) |
14 (51.9) |
| SAEs |
11 (36.7) |
14 (40) |
6 (20.7) |
11 (40.7) |
| AEs leading to treatment discontinuation* |
3 (10) |
8 (22.9) |
0 |
1 (3.7) |
| AEs leading to death** |
3 (10) |
1 (2.9) |
0 |
4 (14.8) |
*For patients in the Erlotinib+MetMAb arm who were Met High: aspiration pneumonia,
obstructive hernia, hypoxia, cerebral infarction, esophageal stenosis, fatigue, NOS,
and nail toxicity.
**AEs leading to death for those who were Met Low: pneumonia, pulmonary embolism,
hemoptysis, NSCLC |
Conclusions
[0321]
- Anti-c-met antibody MetMAb was a selective and potent inhibitor of the Met receptor.
- Met high expression was associated with a worse outcome in placebo-treated patients.
- Treatment with the combination of erlotinib and MetMAb benefited patients with Met
High NSCLC.
- The poorer outcomes for patients with Met Low NSCLC treated with erlotinib + MetMAb
cannot be explained by adverse events.
- Erlotinib + MetMab was well-tolerated and there were no new significant safety findings.
- Results for the overall population verses patients with Met High NSCLC highlight the
importance of using a diagnostic.
Final Analysis based on data cut off date of on or before November 15, 2010
[0322] 128 patients with second or third line NSCLC were enrolled and randomized at 25 global
sites from March 2009 to March 2010 to: (a) MetMAb (15mg/kg IV q3wks) plus erlotinib
treatment (interchangeably termed "ME") (n=64) or (b) placebo plus erlotinib treatment
(interchangeably termed "PE") (n=64). The data cut-off date used in this analysis
was November 15, 2010.
[0323] Patient disposition is shown in Table 11.
Table 11: Patient Disposition
| No. of patients (%) |
Met Diagnostic-Positive |
Met Diagnostic-Negative |
All patients (n=137) |
| Placebo+ erlotinib (n=31) |
MetMAb+ erlotinib (n=35) |
Placebo+ erlotinib (n=31) |
MetMAb+ erlotinib (n=31) |
| Disease progression |
23 (74.2) |
18 (51.4) |
22 (71.0) |
22 (71.0) |
92 (67.2) |
| Adverse event |
2 (6.5) |
7 (20.0) |
1 (3.2) |
1 (3.2) |
11 (8.0) |
| Death |
4 (12.9) |
0 |
1 (3.2) |
2 (6.5) |
7 (5.1) |
| Physician decision |
1 (3.2) |
2 (5.7) |
5 (16.1) |
3 (9.7) |
12 (8.8) |
| Patient decision |
1 (3.2) |
3 (8.6) |
1 (3.2) |
1 (3.2) |
6 (4.4) |
| Sponsor decision |
0 |
0 |
1 (3.2) |
0 |
1 (0.7) |
[0324] Patient demographics are shown in Table 12.
Table 12: Patient Demographics
| |
Erlotinib+Placebo n=64 (%) |
Erlotinib+MetMAb n=64 (%) |
| Median age (range) |
62 (42-83) |
66 (30-83) |
| Sex: male, n (%) |
39 (60.9) |
36 (56.3) |
| Race: White, n (%) |
58 (90.6) |
56 (87.5) |
| ECOG: 0/1, n (%) |
62 (96.9) |
60 (93.8) |
| Non-squamous, n (%) |
48 (75) |
49 (76.6) |
| Squamous, n (%) |
16 (25) |
15 (23.4) |
| Never smoker, n (%) |
8 (12.5) |
10 (15.6) |
| Met Dx pos*, n (%) |
30 (50.8) |
35 (56.5) |
| Kras mutant**, n (%) |
13 (23.2) |
13 (23.2) |
| EGFR mutant**, n (%) |
6 (10.7) |
7 (12.5) |
* Of 121 patients with evaluable tissue samples
** Of 112 patients with evaluable tissue samples. |
Baseline characteristics were well-balanced in the overall (ITT) population including
prevalence of patients having Met diagnostic positive tumors (51%/56.5%; PE/ME), Kras
mutation (23%/23%) and EGFR mutation (11%/12.5%). Tissue was evaluable for Met IHC
analysis in 121 patients (95% of patients), and for EGFR and KRAS mutations in 112
patients.
[0325] Baseline characteristics by Met status are shown in Table 13.
Table 13: Baseline characteristics by Met status.
| |
ITT |
Met Dx Negative |
Met Dx Positive |
| |
Placebo + erlotinib (n=68) |
MetMAb + erlotinib (n=69) |
Placebo + erlotinib (n=31) |
MetMAb + erlotinib (n=31) |
Placebo + erlotinib (n=31) |
MetMAb + erlotinib (n=35) |
| Median age (range) |
63 (42-83) |
64 (30-83) |
61 (42-83) |
63 (45-82) |
64 (44-82) |
66 (30-83) |
| Sex: Male |
62% |
58% |
55% |
65% |
65% |
51% |
| Race: White |
90% |
88% |
90% |
87% |
90% |
91% |
| ECOG PS: 0/1 |
97% |
94% |
100% |
90% |
94% |
97% |
| Squamous |
29% |
29% |
39% |
45% |
16% |
14% |
| Never smoker |
12% |
15% |
3% |
7% |
19% |
20% |
| Met Dx positive* |
50% |
53% |
0% |
0% |
100% |
100% |
| KRAS mutant** |
23% |
23% |
25% |
24% |
23% |
23% |
| EGFR mutant** |
11% |
13% |
14% |
0% |
8% |
23% |
*Of 128 patients with evaluable tissue samples
**Of 112 patients with evaluable tissue samples |
In this study, tissue was obtained from 100% of patients. 95% of patients had adequate
tissue for evaluation of Met by IDC. 54% of patients had "Met high" NSCLC.
[0326] Treatment with MetMAb and erlotinib provided a statistically significant and clinically
meaningful benefit to patients with Met diagnostic positive NSCLC (Figure 13). Both
a PFS benefit (Hazard ratio (HR) 0.53; 95% CI 0.28-0.99; p=0.04,) and an OS benefit
(HR .37; 95% CI 0.19-0.72; p=0.002) were observed in the Met diagnostic positive patients
treated with MetMAb plus erlotinib. Early and sustained separation of the curves was
observed. The addition of MetMAb to erlotinib resulted in a near three-fold reduction
in the risk of death. Median PFS in patients treated with MetMAb + erlotinib (ME)
was 2.9 months, verses 1.5 months in patients treated with placebo+ erlotinib (PE);
median OS in patients treated with MetMAb + erlotinib was 12.6 months verses 3.8 months
in patients treated with placebo + erlotinib).
[0327] Met diagnostic negative NSCLC patients did not benefit from treatment with MetMAb
+ erlotinib (Figure 14). MetMAb increased the risk of progression and death in Met
low NSCLC patient verses treatment with erlotinib and placebo: both median PFS (HR
1.82; 95% CI 0.99-3.32; p=0.05) and median OS (HR 1.78; 95% CI 0.79 - 3.99; p=0.16)
were worse in the MetMAb + erlotinib cohort. ∼70 percent of Met low patients treated
with MetMAb and erlotinib progressed by the first assessment (CAT scan at week 6).
[0328] PFS and OS in the overall population are shown in Figure 15. PFS and OS were not
significantly different in the MetMAb plus erlotinib and placebo plus erlotinib treatment
arms in the overall population. MetMAb plus erlotinib treatment did not show benefit
in the overall population relative to placebo plus erlotinib treatment. The Hazard
rations for PFS and OS in the overall (interchangeably termed "intent to treat" or
ITT) population were 1.09 (95% CI 0.73-1.62; p=0.69) and 0.8 (95% CI 0.5-1.3; p=0.76).
Median PFS and median OS were consistent with previously reported findings in similar
disease settings.
[0329] OS was also examined by subgroups (Figure 16). Met diagnostic positive IHC status
3 and 2 patients showed benefit from MetMAb + erlotinib treatment, with status 3 patients
showing greater benefit. Met diagnostic negative IHC status 0 and 1 patients did not
benefit from MetMAb plus erlotinib treatment, and status 0 patients did worse on MetMAb
+ erlotinib than status 1 patients. Selective benefit of MetMAb + erlotinib treatment
was not observed in other subgroups, including: histology category (non-squamous verses
squamous cell), tobacco history, ECOGCC, EGFR mutation or Kras mutation.
[0330] Figure 17 shows subgroup analysis of OS in Met Diagnostic negative patients.
[0331] Overall survival was also analyzed in key sub-populations of patients: MET FISH positive
patients (defined as greater than or equal to five copies of MET), Met diagnostic
positive/
MET FISH negative, Met diagnostic positive/EGFR wildtype, and Met diagnostic positive/
MET FISH negative/EGFR wildtype (Figure 18). The benefit of adding MetMAb to erlotinib
was not exclusive to
MET FISH positive patients and was observed in
MET FISH negative/Met diagnostic positive patients, suggesting that IHC is a more sensitive
predictor of benefit from MetMAb. The benefit from MetMAb + erlotinib in Met diagnostic
positive patients was not driven by EGFR mutation status.
[0332] Key prognostic variables by Met status are shown in Table 14.
Table 14: Key prognostic variables by Met status
| |
Met Positive (n=65) |
Met Negative (n=56) |
| |
Erlotinib + Placebo (n=30) |
Erlotinib +MetMAb (n=35) |
Erlotinib +Placebo (n=29) |
Erlotinib +MetMAb (n=27) |
| Histopathology (n=128) |
| Adenocarcinoma |
21 (70.0) |
26 (73.3) |
17 (58.6) |
12 (44.4) |
| Squamous |
4 (13.3) |
5 (14.3) |
10 (34.5) |
10 (37.0) |
| Mutational analyses (n=112) |
| Kras mutant |
6 (23.1) |
7 (22.6) |
7 (25.0) |
6 (24.0) |
| EGFR mutant |
2 (7.7) |
7 (22.6) |
4 (14.3) |
0 |
[0333] Met expression was prognostic for a worse outcome (Figure 19). In an analysis of
the erlotinib + placebo -treated patients, Met diagnostic positive patients had increased
risk of progression (HR = 1.7; median PFS of 1.5 months) and increased risk of death
(HR = 3.8; median OS of 3.8 months) relative to Met diagnostic negative patients (median
PFS 2.7 months; median OS of 15.3 months). Thus, Met expression is a prognostic factor
for progression and survival in erlotinib-treated second- or third-line NSCLC patients:
Met diagnostic positive patients did worse when treated with erlotinib, while Met
diagnostic negative patients did better when treated with erlotinib.
[0334] Safety: Treatment with Erlotinib + MetMAb was well-tolerated. Safety data is summarized
in Table 15.
Table 15: Summary of safety data.
| |
Met Diagnostic Positive |
Met Diagnostic Negative |
| No. of patients (%) |
Placebo + erlotinib (n=31) |
MetMAb + erlotinib (n=35) |
Placebo + erlotinib (n=31) |
MetMAb + erlotinib (n=31) |
| Any adverse event |
31 (100) |
35(100) |
31 (100) |
31 (100) |
| Grade ≥3 adverse event |
17 (54.8) |
20 (57.1) |
13 (41.9) |
17 (54.8) |
| Serious adverse event |
11 (35.5) |
15 (42.9) |
9 (29.0) |
13 (41.9) |
| Adverse events leading to MetMAb/placebo discontinuation |
2 (6.5) |
8 (22.9) |
0 |
2 (6.5) |
| Adverse events leading to death |
4 (12.9) |
1 (2.9) |
0 |
3 (9.7) |
Addition of MetMAb did not substantially increased frequency (by greater than or equal
to 10) of any specific adverse event in both diagnostic populations, with the exception
of peripheral edema, which was higher in the MetMAb treated arms in both Met diagnostic
positive and diagnostic negative populations. MetMAb treatment did not add substantial
new toxicities nor exacerbate known erlotinib toxicities regardless of Met diagnostic
status, although a higher proportion of Met diagnostic positive patients on MetMAb
+ erlotinib discontinued due to adverse events and a higher proportion of Met diagnostic
negative patients on MetMAb + erlotinib had significant adverse events and Grade 3
or higher adverse events.
[0335] Tumor growth and disease progression: The rate of tumor growth was not significantly
different between treatment arms of by Met status at Cycle 2, by which time most of
the PFS events had occurred.
[0336] The overall survival treatment effect of MetMAb + erlotinib treatment was also evaluated
in patients using different IHC scoring schemes to define the patients who were scored
as "met positive":
- A less stringent cutoff of greater than or equal to 10% of tumor cells with an IHC
staining intensity of moderate (2+) or high (3+) ("10% Met diagnostic positive")
- A more stringent cutoff of greater than or equal to 90% of tumor cells with an IHC
staining intensity of moderate (2+) or high (3+) ("90% Met diagnostic positive").
Estimates of the treatment effect in patient subsets were expressed as hazard ratios
using an unstratified Cox model, including 95% confidence interval. The results of
this analysis are shown in Figure 21. When using 10% as cutoff, the HR in patients
selected as 10% Met diagnostic positive (n=87) was 0.52, with 95%CI of 0.30, 0.92.
When using 50% as cutoff (i.e., greater than or equal to 50% of tumor cells with an
IHC staining intensity of moderate (2+) or high (3+)), the HR in patients selected
as Met diagnostic positive (n=66) was 0.38, with 95%CI of 0.20, 0.71. When using 90%
as cutoff, the HR in patients selected as 90% Met diagnostic positive (n=47) was 0.30,
with 95%CI of 0.14, 0.64. In patients who were selected as (a) 10% Met diagnostic
positive and (b) not Met diagnostic positive using the 50% cutoff, (n=21), the HR
was 2.83, with 95% CI of 0.53, 15.2. In patients who are selected as (a) Met diagnostic
positive using 50% cutoff and (b) not 90% Met diagnostic positive, (n=19), the HR
was 0.75, with 95% CI of 0.24, 2.42. This detailed analysis of different IHC scoring
schemes supports the use of the definition of Met Diagnostic positive as greater than
or equal to 50% of tumor cells staining at a moderate (2+) or high (3+) intensity
for Met by IHC.
Conclusions
[0337]
- Anti-c-met antibody MetMAb was a selective and potent inhibitor of the Met receptor.
- Met high expression was associated with a worse outcome in placebo-treated patients.
- Treatment with the combination of erlotinib and MetMAb benefited patients with Met
diagnostic positive NSCLC.
- The poorer outcomes for patients with Met diagnostic positive NSCLC treated with erlotinib
+ MetMAb cannot be explained by adverse events.
- Erlotinib + MetMAb were well-tolerated and there were no new significant safety findings.
- Results for the overall population verses patients with Met diagnostic positive NSCLC
highlight the importance of using a diagnostic.
Exploratory biomarker analyses from OAM4558g: a placebo-controlled Phase II study
of erlotinib ±MetMAb in patients with advanced non-small-cell lung cancer (NSCLC)
[0338] Exploratory tumor biomarkers related to c-Met and/or EGFR signaling were measured
by FISH, qRT-PCR or various mutation detection techniques from archival tumor tissue
specimens. Plasma HGF levels were measured by ELISA. Analyses with outcome were carried
out independent of Met clinical diagnostic status.
Results: Baseline characteristics of patients with evaluable tumor or plasma specimens were
generally comparable.
[0339] EGFR and KRAS mutations: EGFR and KRAS data were obtained from n=112 (93%) patients,
MET exon 14 variants from n=87 (72%) patients and MET N375S snp from n=113 (93%) patients.
EGFR mutations predicted for 6/7 objective responses on study and were comparable
between treatment arms. KRAS mutations (detected in 23% (26/112) of evaluable specimens)
were mutually exclusive with EGFR mutations (detected in 12% (13/112) of evaluable
specimens) and did not significantly impact outcome with MetMAb in the ITT or Met
diagnostic positive/negative populations.
[0340] MET variant data: The MET exon 14 deletion mutation was identified in 1% (n=1) of
evaluable specimens. The MET N375S snp was identified in 11% (n=12) of evaluable specimens.
Due to the imbalance between treatment arms, outcome analyses were not able to be
performed.
[0341] MET FISH: FISH data were obtained from n=96 (75%) patients. There was a non-significant
trend towards improved outcome in EGFR-wildtype patients that were MET FISH positive,
as defined by ≥5 copies of MET/cell, but not a lower thresholds (e.g., ≥4 copies (HR=0.89,
p=0.82)). Overall, 74% of FISH positive patients were also Met diagnostic positive.
True gene amplification was detected in 8% of patients. However, EGFR-wildtype patients
that were Met diagnostic positive and MET FISH negative displayed a trend for improved
outcome (OS HR=0.45, p=0.07), indicating that assessing for met gene amplification
using FISH potentially missed a large subgroup of patients who may benefit from MetMAb
therapy. There was no significant difference in OS in MET and EGFR FISH positive patients.
[0342] MET and
EGFR pathway gene analysis by qRT-PCR, and plasma HGF level analysis: mRNA data were obtained
from n=67 patients (49%) (Figure 20). A non-statistically significant association
of tumor
MET mRNA levels with the Met IHC clinical score was observed; however, expression of
MET mRNA or other genes did not independently predict for PFS or OS benefit in the subset
of patients with mRNA data (Table 16).
Table1 6. Association of
MET, EGFR, AREG and
EREG expression with outcome.
| mRN A (median) |
|
Placebo+Erlotinib |
MetMAb+Erlotinib |
HR |
95%CI |
p-value |
| n |
Median (mo) |
n |
Median (mo) |
| MET (3.16) |
High |
12 |
6.5 |
22 |
8.7 |
0.59 |
0.25-1.4 |
0.23 |
| Low |
19 |
15.3 |
14 |
11.7 |
1.48 |
0.54-4.1 |
0.45 |
| EGFR (7.75) |
High |
13 |
8.3 |
21 |
7.1 |
1.1 |
0.44-2.76 |
0.83 |
| Low |
18 |
7.1 |
15 |
11.7 |
0.88 |
0.33-2.33 |
0.80 |
| AREG (7.11) |
High |
13 |
8.3 |
21 |
NA |
0.77 |
0.30-1.99 |
0.58 |
| Low |
18 |
6.9 |
15 |
6.5 |
1.31 |
0.53-3.25 |
0.55 |
| EREG (0.26) |
High |
13 |
6.9 |
21 |
10.2 |
0.67 |
0.28-1.63 |
0.37 |
| |
Low |
18 |
9.2 |
15 |
8.1 |
1.34 |
0.50-3.60 |
0.57 |
Baseline plasma HGF data were obtained from n=96 patients (70%). A non-significant
trend for improved outcome in patients with low HGF protein levels in plasma collected
prior to treatment was evident.
Conclusions: The data presented herein support Met IHC as the most robust, sensitive and independent
predictor of OS benefit from MetMAb treatment. Further investigation of these biomarkers
is warranted given the small size of this study.
[0343] Although the foregoing invention has been described in some detail by way of illustration
and example for purposes of clarity of understanding, the descriptions and examples
should not be construed as limiting the scope of the invention.
[0344] The following numbered paragraphs (paras.) contain further statements of various
aspects of the present invention:-
- 1. A method for identifying a cancer patient who is likely to respond to treatment
with a c-met antagonist comprising the step of determining whether the patient's cancer
has a high amount of c-met biomarker, wherein the c-met biomarker expression indicates
that the patient is likely to respond to treatment with the c-met antagonist.
- 2. A method for determining cancer patient prognosis, comprising the step of determining
whether the patient's cancer has a high amount of c-met biomarker, wherein the c-met
biomarker expression indicates that the patient is likely to have increased overall
survival (OS) and/or progression-free survival (PFS) when the patient is treated with
a c-met antagonist.
- 3. A method for identifying a cancer patient who is less likely to be respond to treatment
with a c-met antagonist comprising the step of determining whether the patient's cancer
has a low amount of c-met biomarker, wherein the c-met biomarker expression indicates
that the patient is less likely to respond to treatment with the c-met antagonist.
- 4. The method of paras 1 or 2, wherein c-met biomarker protein expression is determined
in a sample from the patient using immunohistochemistry (IHC).
- 5. The method of para 4, wherein IHC score is 2 or 3.
- 6. The method of para 4, wherein high c-met biomarker expression is 50% or more of
the tumor cells with moderate c-met staining intensity, combined moderate/high c-met
staining intensity or high c-met staining intensity.
- 7. The method of para 10, wherein c-met expression staining intensity is determined
relative to c-met staining intensity of control cell pellets.
- 8. The method of para 7, wherein cell line A549 has moderate c-met staining intensity.
- 9. The method of para 7, wherein cell line H441 has strong c-met staining intensity.
- 10. The method of paras 1 or 2, wherein c-met biomarker expression is nucleic acid
expression and is determined in a sample from the patient using rtPCR, RNN-seq, microarray
analysis, SAGE, MassARRAY technique, or FISH.
- 11. The method of any of paras 1, 2, and 4-10, wherein the patient has greater PFS
and/or OS relative to a patient who does not have high c-met biomarker.
- 12. The method of para 3, wherein c-met biomarker expression is protein expression
and is determined in a sample from the patient using immunohistochemistry (IHC).
- 13. The method of para 12, wherein the IHC score is 1 or 0.
- 14. The method of para 13, wherein the IHC score is 0.
- 15. The method of para 12, wherein low c-met biomarker expression is negative c-met
staining, less than 50% of tumor cells with weak or combined weak and moderate c-met
staining intensity, or 50% or more tumor cells with weak or combined weak and moderate
c-met staining intensity but less than 50% tumor cells with moderate or combined moderate
and strong c-met staining intensity.
- 16. The method of para 15, wherein c-met expression staining intensity is determined
relative to c-met staining intensity of control cell pellets.
- 17. The method of para 16, wherein cell line H1155 has negative c-met staining intensity.
- 18. The method of para 16, wherein cell line HEK-293 has low c-met staining intensity.
- 19. The method of any of paras 1-18, wherein the patient sample is of the patient's
cancer.
- 20. The method of para 19, wherein the sample is obtained prior to treatment with
c-met antagonist.
- 21. The method of para 20, wherein the sample is obtained prior to treatment with
a cancer medicament.
- 22. The method of para 20, wherein the sample is obtained after the cancer has metastasized.
- 23. The method of any of paras 1-22, wherein the sample is formalin fixed and paraffin
embedded.
- 24. The method of any of paras 1-23, wherein the c-met IHC is performed using anti-c-met
antibody SP44.
- 25. The method of any of paras 1-24, wherein the cancer is non-small cell lung cancer,
renal cell cancer, pancreatic cancer, gastric carcinoma, bladder cancer, esophageal
cancer, mesothelioma, melanoma, breast cancer, thyroid cancer, colorectal cancer,
head and neck cancer, osteosarcoma, prostate cancer, or glioblastoma.
- 26. The method of para 25, wherein the cancer is non-small cell lung cancer (NSCLC).
- 27. The method of para 26, wherein the NSCLC is second-line or third-line locally
advanced or metastatic non-small cell lung cancer.
- 28. The method of paras 26 or 27, wherein the NSCLC is adenocarcinoma.
- 29. The method of paras 26 or 27, wherein the NSCLC is squamous cell carcinoma.
- 30. The method of any of paras 1-29, wherein the c-met antagonist is an antagonist
anti-c-met antibody.
- 31. The method of para 30, wherein the anti-c-met antibody comprises a (a) HVR1 comprising
sequence GYTFTSYWLH (SEQ ID NO: 1); (b) HVR2 comprising sequence GMIDPSNSDTRFNPNFKD
(SEQ ID NO: 2); (c) HVR3-HC comprising sequence ATYRSYVTPLDY (SEQ ID NO: 3); (d) HVR1-LC
comprising sequence KSSQSLLYTSSQKNYLA (SEQ ID NO: 4); (e) HVR2-LC comprising sequence
WASTRES (SEQ ID NO: 5); and (f) HVR3-LC comprising sequence QQYYAYPWT (SEQ ID NO:
6).
- 32. The method of para 31, wherein the anti-c-met antibody is monovalent and comprises
(a) a first polypeptide comprising a heavy chain, said polypeptide comprising the
sequence: EVQLVESGGGLVQPGGSLRLSCAASGYTFTSYWLHWVRQAPGKGLEWVGMIDPSNS DTRFNPNFKDRFTISADTSKNTAYLQMNSLRAEDTAVYYCATYRSYVTPLDYWGQGT
LVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPC
PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNA KTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE
PQVYTLPPSREEMTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS FFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
(SEQ ID NO: 11); (b) a second polypeptide comprising a light chain, the polypeptide
comprising the sequence DIQMTQSPSSLSASVGDRVTITCKSSQSLLYTSSQKNYLAWYQQKPGKAPKLLIYWAST
RESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYYAYPWTFGQGTKVEIKRTVAA PSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKD
STYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 12); and a third polypeptide
comprising a Fc sequence, the polypeptide comprising the sequence DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV
DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKT
TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 13),
wherein the heavy chain variable domain and the light chain variable domain are present
as a complex and form a single antigen binding arm, wherein the first and second Fc
polypeptides are present in a complex and form a Fc region that increases stability
of said antibody fragment compared to a Fab molecule comprising said antigen binding
arm.
- 33. The method of any of paras 1-32, wherein the c-met antagonist is one or more of
crizotinib, tivantinib, carbozantinib, MGCD-265, ficlatuzumab, humanized TAK-701,
rilotumumab, foretinib, h224G11, DN-30, MK-2461, E7050, MK-8033, PF-4217903, AMG208,
JNJ-38877605, EMD1204831, INC-280, LY-2801653, SGX-126, RP1040, LY2801653, BAY-853474,
and/or LA480.
- 34. The method of any of para 33, wherein treatment is in combination with treatment
with an EGFR antagonist.
- 35. The method of para 34, wherein the EGFR antagonist is erlotinib.
- 36. The method of any of paras 1-32, wherein the c-met antagonist is onartuzumab and
treatment further comprises treatment with erlotinib.
- 37. The method of para 33, wherein the c-met antagonist is crizotinib, tivantinib,
carbozantinib, MGCD-265, ficlatuzumab, humanized TAK-701, or foretinib, and treatment
further comprises treatment with erlotinib.
- 38. A method for determining c-met biomarker expression, comprising the step of determining
whether a patient's cancer has a high level of c-met biomarker, wherein c-met biomarker
expression is protein expression and is determined in a sample from the patient using
IHC, wherein high c-met biomarker expression is 50% or more of the tumor cells with
moderate c-met staining intensity, combined moderate/high c-met staining intensity
or high c-met staining intensity, wherein c-met expression is detected using a c-met
antibody, wherein the c-met biomarker expression indicates that the patient is likely
to have increased OS and/or PFS when the patient is treated with a c-met antagonist.
- 39. A method for treating a patient with cancer comprising administering a therapeutically
effective amount of a c-met antagonist to the patient if the patient's cancer has
been found to have a high amount of a c-met biomarker.
- 40. The method of para 39, wherein the c-met antagonist is an anti-c-met antibody.
- 41. The method of para 39 wherein the anti-c-met antibody is onartuzumab.
- 42. The method of any of paras 39-41, wherein c-met biomarker protein expression is
determined in a sample from the patient using immunohistochemistry (IHC).
- 43. The method of para 42, wherein IHC score is at least 2.
- 44. The method of para 42, wherein high c-met biomarker expression is 50% or more
of the tumor cells with moderate c-met staining intensity, combined moderate/high
c-met staining intensity or high c-met staining intensity.
- 45. The method of para 44, wherein c-met expression staining intensity is determined
relative to c-met staining intensity of control cell pellets.
- 46. The method of para 45, wherein cell line A549 has moderate c-met staining intensity.
- 47. The method of para 45, wherein cell line H441 has strong c-met staining intensity.
- 48. The method of para 42, wherein c-met biomarker expression is nucleic acid expression
and is determined in a sample from the patient using rtPCR, RNN-seq, microarray analysis,
SAGE, MassARRAY technique, or FISH.
- 49. The method of any of paras 39-48, wherein the patient has greater PFS and/or OS
relative to a patient who does not have high c-met biomarker.
- 50. A method for treating a patient with cancer comprising administering a therapeutically
effective amount of a medicament other than a c-met antagonist to the patient if the
patient's cancer has been found to have a low amount of a c-met biomarker.
- 51. The method of para 50, wherein c-met biomarker protein expression is determined
in a sample from the patient using immunohistochemistry (IHC).
- 52. The method of para 51, wherein the IHC score is 1 or lower.
- 53. The method of para 51, wherein low c-met biomarker expression is detected by the
presence of negative c-met staining, less than 50% of tumor cells with weak or combined
weak and moderate c-met staining intensity, or 50% or more tumor cells with weak or
combined weak and moderate c-met staining intensity but less than 50% tumor cells
with moderate or combined moderate and strong c-met staining intensity.
- 54. The method of para 53, wherein c-met expression staining intensity is determined
relative to c-met staining intensity of control cell pellets.
- 55. The method of para 54, wherein cell line H1155 has negative c-met staining.
- 56. The method of para 54, wherein cell line 293 has low c-met staining intensity.
- 57. The method of any of paras 50-56, wherein the cancer is non-small cell lung cancer,
renal cell cancer, pancreatic cancer, gastric carcinoma, bladder cancer, esophageal
cancer, mesothelioma, melanoma, breast cancer, thyroid cancer, colorectal cancer,
head and neck cancer, osteosarcoma, prostate cancer, or glioblastoma.
- 58. The method of para 57, wherein the cancer is non-small cell lung cancer (NSCLC).
- 59. The method of para 58, wherein the NSCLC is second-line or third-line locally
advanced or metastatic non-small cell lung cancer.
- 60. The method of paras 58 or 59, wherein the NSCLC is adenocarcinoma.
- 61. The method of paras 58 or 59, wherein the NSCLC is squamous cell carcinoma.
- 62. The method of para 2, wherein the patient has NSCLC and is treated with a combination
of anti-c-met antibody and an EGFR antagonist.
- 63. The method of para 62, wherein the EGFR antagonist is erlotinib.
- 64. The method of para 6, wherein the patient has NSCLC and is treated with (a) onartuzumab
at a dose of about 15 mg/kg every three weeks; and (b) erlotinib (N-(3-ethynylphenyl)-6,7-bis(2-methoxyethoxy)-4-quinazolinamine)
at a dose of 150 mg, each day of a three week cycle.
- 65. A method for selecting a therapy for a patient with cancer comprising determining
expression of a c-met biomarker in the patient's cancer, and selecting a cancer medicament
based on the level of expression of the biomarker.
- 66. The method of para 65 wherein the patient is selected for treatment with a c-met
antagonist if the cancer sample expresses the biomarker at a high level.
- 67. The method of para 65 wherein the patient is selected for treatment with a cancer
medicament other than a c-met antagonist if the cancer sample expresses the biomarker
at a low or substantially undetectable level.
- 68. A method for advertising a c-met antibody comprising promoting, to a target audience,
the use of the c-met antibody for treating a patient with cancer based on expression
of c-met biomarker.
- 69. The method of para 68, wherein the promotion is by a package insert accompanying
a commercial formulation of the anti-c-met antibody.
- 70. The method of para 68, wherein the promotion is by a package insert accompanying
a commercial formulation of a second medicament.
- 71. The method of para 70, wherein the second medicament is an EGFR antagonist.
- 72. The method of para 71, wherein the anti-c-met antibody is MetMAb and the EGFR
antagonist is erlotinib.
- 73. The method of para 68, wherein the patient is selected for treatment with a c-met
antagonist if the cancer sample expresses the biomarker at a high level.
- 74. The method of para 68, wherein the promotion is by a package insert where the
package inset provides instructions to receive therapy with anti-c-met antibody in
combination with an EGFR antagonist.
- 75. The method of para 74, wherein the promotion is followed by the treatment of the
patient with the anti-c-met antibody with or without the second medicament.
- 76. A diagnostic kit comprising one or more reagent for determining expression of
a c-met biomarker in a sample from a NSCLC patient, wherein detection of a high amount
of c-met biomarker means increased PFS or OS when the patient is treated with a c-met
antagonist, and wherein detection of a low or substantially undetectable amount of
c-met biomarker means a decreased PFS when the patient is treated with the c-met antagonist.
- 77. The diagnostic kit of para 76 further comprising instructions to use the kit to
select a c-met medicament to treat the NSCLC patient if a high amount of c-met biomarker
is determined.
- 78. A method of making the diagnostic kit of para 76, comprising combining in a package
a pharmaceutical composition comprising a cancer medicament and a package insert indicating
that the pharmaceutical composition is for treating a patient with cancer based on
expression of c-met biomarker.
