BACKGROUND
[0001] Interleukin-1 alpha (IL-1α) and interleukin-1 beta (IL-1β) are prototypic members
of a family of immunoregulatory cytokines and have several prominent roles in regulating
the immune system. IL-1α and IL-1β bind to the interleukin-1 receptor I (IL-1 Rl),
leading to the engagement of the secondary receptor, interleukin-1 receptor accessory
protein (IL-1 RAcP). Signaling agonized by IL-1α and IL-1β leads to amplified T cell
responses, including the proliferation and survival of naive T cells and the development
of T
H17 cells.
SUMMARY
[0004] The invention is as defined in the appended claims. The references to methods of
treatment in the subsequent paragraphs of this description are to be interpreted as
references to the proteins, pharmaceutical compositions and medicaments of the present
invention for use in a method for treatment of the human (or animal) body by surgery
or therapy (or for diagnosis).
[0005] In one aspect, this disclosure features an isolated protein including an cytokine
domain that contains amino acid residues from two parental cytokines domains as defined
in the claims.
[0006] The cytokine domain binds to IL-1RI and includes receptor binding features from two
different parental cytokine domains IL-1β and IL-1Ra as defined in the claims.. In
the context of the present invention, the first parental cytokine domain is IL-1β,
and the second parental cytokine domain is IL-1Ra, as is defined in the claims. Disclosed
herein but not claimed, the first parental cytokine domain can be IL-1α, and the second
parental cytokine domain can be IL-1Ra.
[0007] The cytokine domain of the claimed isolated protein can also include amino acids
from a second parental cytokine domain at one or more positions in the domain that
impair interaction with a cytokine secondary receptor (e.g., IL-1RAcP).
[0008] The cytokine domain not as claimed can be a chimeric domain having segments that
are at least 5, 6, 10, 15, 20, or 25 amino acids in length and that are at least 80,
85, 88, 90, 92, 95, or 100% identical to corresponding segments from at least two
different parental cytokine domains, such as a first and second parental cytokine
domain.
[0009] The cytokine domain not as claimed includes at least two segments of at least 5,
6, 10, 15, 20, or 25 amino acids in length that are at least 80, 85, 88, 90, 92, 95,
or 100% identical to corresponding segments of a first parental cytokine domains,
and the amino acids that are not in such segments are predominantly (e.g., at least
50, 60, 70, 80, 85, 88, 90, 92, 95, or 100%) identical to corresponding residues in
the second parental cytokine domain.
[0010] The cytokine domain not as claimed includes (i) at least two segments of at least
5, 6, 10, 15, 20, or 25 amino acids in length that are at least 80, 85, 88, 90, 92,
95, or 100% identical to corresponding segments of a first parental cytokine domains,
and (ii) at least one, two or three segments, e.g., of at least 5, 6, 7, 8, 10, or
15 amino acids in length, that are identical to a second parental cytokine domain.
[0011] For example, the cytokine domain not as claimed can include a first segment of 20-50,
25-50, 30-45, or 30-40 amino acids (e.g., 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,
39, or 40), and a second segment of 20-45, 20-40, 25-40, or 25-35 amino acids (e.g.,
25, 26, 27, 28, 29, 30, 31, 32, 33, 34, or 35), each identical (or at least 80, 85,
88, 90, 92, 95, or 98% identical) to a first parental cytokine domain (e.g., IL-1Ra),
and a third segment that is identical (or at least 80, 85, 88, 90, 92, 95, or 98%
identical) to a second parental cytokine domain (e.g., IL-1β or IL-1α). For example,
the third segment can be between 55-90, 60-90, 60-85, or 70-85 amino acids in length,
e.g., 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, or 85 amino acids in length.
[0012] In some embodiments: the first segment can be a segment at least 80, 85, 88, 90,
92, 95, 98, or 100% to WDVNQKTFYLRNNQLVAGYLQGPNV (SEQ ID NO:9, also termed the A1
segment herein, and corresponding to residues 16-40 of SEQ ID NO:3 and residues 11-36
according to IL-1β numbering). The second segment can be a segment at least 80, 85,
88, 90, 92, 95, 98, or 100% to residues 120-140 or 120-141 of SEQ ID NO:3 (IL-1Ra),
corresponding to residues 121-139 or 121-140 (according to IL-1β numbering). The third
segment can be at least 80, 85, 88, 90, 92, 95, 98, or 100% to residues 45-100 or
42-120 from IL-1β (SEQ ID NO:1).
[0013] In some embodiments, the first segment can be a segment at least 80, 85, 88, 90,
92, 95, 98, or 100% to residues 14-45 of SEQ ID NO:3 (corresponding to residues 9-41
according to IL-1β numbering). The second segment can be a segment at least 80, 85,
88, 90, 92, 95, 98, or 100% to residues 120-145 of SEQ ID NO:3 (corresponding to residues
121-145 according to IL-1β numbering) or residues 120-147 of SEQ ID NO:3 (corresponding
to residues 121-147 according to IL-1β numbering). As defined in the appended claims,
at least residues 11-41 and 120-147 (according to IL-1β numbering) are collectively
at least 90, 92, 95, 98, or 100% identical to corresponding residues in IL-1Ra.
[0014] In some embodiments, a terminus of one of the segments of the first IL-1 family cytokine
domain is located within five, four, three, two, or one amino acids of amino acid
41 of SEQ ID NO:1 and a terminus of one of the segments of the first IL-1 family cytokine
domain is located within five, four, three, two, or one amino acids of amino acid
121 of SEQ ID NO:1.
[0015] The domain not as claimed includes a segment having an N-terminus at a position within
five, four, three, two, or one amino acids of amino acid 42 of SEQ ID NO:1 and a C-terminus
within five, four, three, two, or one amino acids of amino acid 120 of SEQ ID NO:1,
and/or a segment having an N-terminus at a position within five, four, three, two,
or one amino acids of amino acid 121 of SEQ ID NO:1 and a C-terminus within five,
four, three, two, or one amino acids of amino acid 145 of SEQ ID NO:1.
As defined in the appended claims, residues in the domain at positions corresponding
to 11-41 and 120-147 (according to IL-1β numbering) are collectively at least 90,
92, 95, 98, or 100% identical to corresponding residues in IL-1Ra.
[0016] In some embodiments, the cytokine domain includes one, two, three or more of the
following sequences: WDVNQKTFYLRNNQLVAGYLQGPNV (SEQ ID NO:9); NLEEK (SEQ ID NO:10);
RIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEK(SEQ ID NO:11); AMEADQP(SEQ ID NO:12); FLCTAMEADQPVSLTNMPDEGVMVTKFY(SEQ
ID NO:13); and/or sequences at least 80, 85, 88, 90, 92, 95, 98, or 100% identical
to the foregoing. In some embodiments, the cytokine domain includes one, two, three
or more of the following sequences: VQGEESNDKI (SEQ ID NO:14); KKKMEKRF (SEQ ID NO:15);
and FSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKN
[0017] YPKKKMEKRFVFNKIEINNKLEFES (SEQ ID NO:16); and/or sequences at least 80, 85, 88, 90,
92, 95, 98, or 100% identical to the foregoing.
[0018] The cytokine domain not as claimed includes sequences that are at least 80, 85, 88,
90, 92, 95, or 100% identical to one, two, three, or all of beta strands β2, β3, β10
and β11 of IL-1Ra. The cytokine domain not as claimed includes sequences that are
at least 80, 85, 88, 90, 92, 95, or 100% identical to one, two, three, or all of β4,
β6, β7, and β8 of IL-1β, or to β4, β5, β6, β7, and β8 of IL-1β.
[0019] The cytokine domain not as claimed does not contain a segment that is greater than
80, 85, 90, 95, or 100% identical to amino acids I46-G59, A55-G59, A55-V83, I60-V83,
N84-D95, I46-S110, V49-S110, or I46-G118 of SEQ ID NO:3. The cytokine domain not as
claimed does not contain a segment that is greater than 80, 85, 90, 95, or 100% identical
to amino acids N7-V41, R11-M36, N102-D145, or Y121-D145 of SEQ ID NO:1.
[0020] Generally, the cytokine domain is not naturally occurring. It differs from human
IL-1 family cytokine domains. For example, it is less than 98, 95, 90, 85, 80, 75,
70, 65, 60, or 55% identical to IL-1Ra (SEQ ID NO:3) and/or IL-1β (SEQ ID NO:1). The
cytokine domain can also be at least 30, 40, 45, 50, 55, 60, 65, 70% identical to
such cytokine. For example, the chimeric domain can be between 30-95%, 40-90%, or
45-85% identical to IL-1Ra and/or IL-1β. For example, the chimeric domain can be between
40-90% identical to IL-1β and 35-85% identical to IL-1Ra; between 40-80% identical
to IL-1β and 45-80% identical to IL-1Ra; between 45-72% identical to IL-1β and 45-80%
identical to IL-1Ra; between 45-72% identical to IL-1 β and 53-80% identical to IL-1Ra;
between 50-72% identical to IL-1β and 53-70% identical to IL-1Ra; between 60-72% identical
to IL-1β and 53-68% identical to IL-1Ra; between 65-72% identical to IL-1β and 54-60%
identical to IL-1Ra; or between 68-72% identical to IL-1β and 54-57% identical to
IL-1Ra. The chimeric domain not as claimed can be between 40-90% identical to IL-1α
and 35-85% identical to IL-1Ra; between 40-80% identical to IL-1α and 45-80% identical
to IL-1Ra; between 45-72% identical to IL-1α and 45-80% identical to IL-1Ra; between
45-72% identical to IL-1α and 53-80% identical to IL-1Ra; between 50-72% identical
to IL-1α and 53-70% identical to IL-1Ra; between 60-72% identical to IL-1α and 53-68%
identical to IL-1Ra; between 65-72% identical to IL-1α and 54-60% identical to IL-1Ra;
or between 68-72% identical to IL-1α and 54-57% identical to IL-1Ra.
[0021] The cytokine domain as is defined in the claims differs from IL-1Ra, and binds to
the receptor while including a Site C and/or Site D characteristic of a naturally
occurring receptor antagonist (such as IL-1Ra). For example, the domain is less than
98, 95, 92, 90, 85, and 80% identical from human IL-1β and/ IL-1Ra. For example, the
domain is between 40-95%, 40-90% or 45-85% identical to IL-1Ra. The domain can also
be between 40-95%, 40-90% or 45-85% to IL-1β. The cytokine domain not as claimed includes:
at least 40, 45, 50, 55, 60, 65, 70, 75, 80 or 85% amino acids from a first parental
cytokine domain that is an agonist of cytokine signaling.
[0022] In some embodiments, the cytokine domain as defined in the claims has greater amino
acid identity (e.g., at least 5, 10, 15, or 20% greater) to a receptor agonist (such
as IL-1β or IL-1α) than to a receptor antagonist (IL-1Ra), but functions as an antagonist
of IL-1RI.
[0023] In some embodiments, the cytokine domain as defined in the claims is completely chimeric,
e.g., each amino acid in the domain is from one of the parental cytokine domains as
defined in the claims, e.g., one of two parental cytokine domains or one of three
or more parental cytokine domains as defined in the claims. For example, the parental
cytokine domains are human cytokine domains or non-human primate cytokine domains.
In some embodiments, the cytokine domain as defined in the claims is partially chimeric,
e.g., not all amino acids in the domain are from one of the parental cytokine domains.
[0024] As defined in the claims, the isolated protein binds to IL-1RI and antagonizes IL-1RI
receptor signaling activity. The protein may not substantially induce IL-6 production
when contacted to IL-1β responsive human cells and/or does not substantially induce
production of an IL-1β responsive reporter gene, e.g., at concentrations of 10 µg/ml,
100 µg/ml, or 1 mg/ml. Generally, the protein inhibits signaling by IL-1β (e.g., at
a concentration of 0.1 ng/ml such as in a cellular assay described herein) with an
IC50 of less than 100, 50, 20, 10, or 5 nM. The protein can inhibit signaling by IL-1β
with an IC50 that is less than that of IL-1Ra, e.g., at least 10, 20, or 50% lower.
[0025] In certain embodiments, the cytokine domain binds to e.g., with the same or better
affinity than one of the parental cytokine domains. In some embodiments, the cytokine
domain binds to IL-1RI with K
D of less than 100, 50, 20, 10, 5, or 1 nM, or less than 500, 400, 100, or 50 pM. For
example, the association constant can be greater than 1×10
4, 3×10
4, 1×10
5, or 1×10
6 M
-1s
-1, and the dissociation can be less than 1×10
-3, 1×10
-4, 6×10
-4, or 6×10
-5 s
-1.
[0026] In some embodiments, the cytokine domain binds to IL-1RI with a better affinity (e.g.,
lower K
D) and/or a slower dissociation rate than IL-1β or IL-1Ra. For example, the cytokine
domain can bind to IL-1RI with a dissociation constant less than or equal to that
of IL-1Ra and/or with an association constant greater or equal to that of IL-1β.
[0027] The cytokine domain not as claimed can be between approximately 120-180 or 140-170
amino acids in length. In the context of the present invention, the protein defined
in the appended claims comprises a chimeric interleukin-1 (IL-1) family cytokine domain
of 148-160 amino acids in length, such as 150-156 amino acids in length. In some embodiments,
the domain is 152 or 153 amino acids in length. Typically the domain includes at least
10, 11, or 12 β-strands, and is stably folded. In some embodiments, the cytokine domain
has a Tm of at least 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, or 64°C,
as described herein. It can have a Tm of between 51-61, 51-66, 56-61, or 56-66°C.
In some embodiments, the cytokine domain does not begin unfolding until at least 48,
50, 51, 55, 57, 58, or 59°C. For example, it has a Tm that is at least within 10°C
or 5°C of the Tm of IL-1Ra and/or IL-1β in a physiological buffer. In some embodiments,
it is more thermostable than IL-1Ra and/or IL-1β in a physiological buffer. For example
the domain can have a Tm that is at least 2, 4, 6, 7, or 8°C greater than the Tm of
IL-1Ra and/or IL-1β in a physiological buffer, e.g., between about 5-12, 5-10, or
7-10°C greater than the Tm of IL-1Ra and/or IL-1β at a concentration of about 0.5
mg/ml.
[0028] Examples of IL-1 cytokine family members include IL-1α, IL-1β, IL-1Ra, IL-18, IL-1F5,
IL-1F6, IL-1F7, IL-1F8, IL-1F9, IL-1F10, and IL-33.
[0029] The chimeric domain not as claimed includes at least one segment of length at least
five, six, seven, eight, nine, ten, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, or
70 amino acids and having amino acid identity to (or at least 80, 82, 85, 87, 90,
92, 94, 95, 96, 97, 98, or 99% identity to) to a first IL-1 family cytokine, and another
segment of length of length at least five, six, seven, eight, nine, ten, 15, 20, 25,
30, 35, or 40 amino acids and having amino acid identity to (or at least 80, 82, 85,
87, 90, 92, 94, 95, 96, 97, 98, or 99% identity to) to a second IL-1 family cytokine.
The chimeric domain not as claimed can be less than 90, 85, 80, or 75% identical to
one or both of the first and second IL-1 family cytokine.
[0030] The first and second IL-1 family cytokines are IL-1β and IL-1Ra, as is defined in
the claims. The first and second IL-1 family cytokines not claimed are selected from
the group consisting of IL-1F5, IL-1F6, IL-1F7, and IL-1F8.
[0031] In one embodiment, the chimeric domain as defined by the claims is identical to the
first IL-1 family cytokine at at least 50, 60, 70, 80, 90, 100, 110, or 120 positions
and is identical to the second IL-1 family cytokine at at least 50, 60, 70, 80, 90,
100, 110, or 120 positions (including positions that may individually be identical
to both such cytokines).
[0032] In one embodiment, the chimeric domain includes at least two, three, or four discontinuous
segments, each of length at least five, six, seven, eight, nine, ten, 15, or 20 amino
acids and having amino acid identity to (or at least 80, 82, 85, 87, 90, 92, 94, 95,
96, 97, 98, or 99% identity to) corresponding segments of human IL-1β and including
amino acids predominantly from human IL-1Ra as defined in the claims at remaining
positions. As defined in the claims, the chimeric domain includes 5, 6, or 7 segments,
wherein adjacent segments are from different parental IL-1 family cytokine domains,
as is defined in the claims. The chimeric domain not as claimed includes at least
one, two, or three of: (i) a segment of at least 50, 60, 65, 70, or 75 amino acids
in length from IL-1β, (ii) a segment of at least 15, 20, 25 amino acids in length
from IL-1Ra; and (iii) another segment of at least 15, 20, 25 amino acids in length
from IL-1Ra.
[0033] As defined in the appended claims, the discontinuous segments includes residues (i)
1-6 and 45-61, (ii) 1-6 and 86-95, (iii) 45-61 and 86-95, (iv) 1-6 and 148-153, (v)
45-61 and 148-153, or (vi) 86-95 and 148-153, according to the numbering of such positions
in IL-1β. The three discontinuous segments from IL-1β as defined in the appended claims
include, e.g., residues 1-8, 42-120, and 141-153, residues 1-10, 37-125, and 131-153,
or residues 1-6, 45-61, 86-95, and 148-153, according to the numbering of such positions
in IL-1β. In one embodiment, one or more of the borders of the discontinuous segments
are located at positions wherein the first and second IL-1 family cytokines are identical
or are conserved.
[0034] In some embodiments, the cytokine domain as defined in the claims includes: (a) amino
acids identical to IL-1Ra at the following positions ARG11, SER13, GLN14, GLN15, GLU25,
LYS27, LEU29, HIS30, LEU31, GLN32, GLY33, GLN34, ASP35, MET36, GLN38, GLN39, ALA127,
GLU128, ASN129, MET130, and GLN141 (according to the numbering of IL-1β) and (b) amino
acids identical to IL-1β at the following positions: ALA1, PRO2, VAL3, ARG4, LEU6,
PHE46, GLN48, GLU51, SER52, ASN53, LYS55, ILE56, PRO57, LYS92, LYS93, LYS94, LYS103,
GLU105, ASN108, GLN149, PHE150, and SER152.
[0035] In some embodiments, the cytokine domain as defined in the claims includes sequences
that are at least 80% identical (collectively) to beta strands β2, β3, β10 and β11
of IL-1Ra and sequences that are at least 80% identical (collectively) to beta strands
β4, β6, β7, and β8 of IL-1β. In some embodiments, the cytokine domain as defined in
the claims includes sequences that are identical to beta strands β2, β3, β10 and β11
of IL-1Ra and sequences that are identical to beta strands β4, β6, β7, and β8 of IL-1β.
[0036] The cytokine domain as defined in the claims differs from IL-1Ra, for example, the
cytokine domain is less than 99, 98, 95, 90, 85, 80, 75, 70, 65, 60% identical to
IL-1Ra, and/or at least 30, 40, 45, 50, 55, 60, 65, 70% identical to IL-1Ra, e.g.,
between 40-95%, 40-90%, or 45-85% identical to IL-1Ra. In some embodiments, the cytokine
domain does not contain a segment that is greater than 80, 85, 90, 95, or 100% identical
to amino acids I46-G59, A55-G59, A55-V83, I60-V83, N84-D95, I46-S110, V49-S110, or
I46-G118 of SEQ ID NO:3. In some embodiments, the cytokine domain does not contain
a segment that is greater than 80, 85, 90, 95, or 100% identical to amino acids N7-V41,
R11-M37, N102-D144, or Y121-D144 of SEQ ID NO:1.
[0037] In some embodiments, the inhibitor binds to IL-1RI with K
D of less than 100, 50, 20, 10, 5, or 1 nM. In some embodiments, the inhibitor binds
to IL-1RI with a better affinity (e.g., lower K
D) and/or a slower dissociation rate than IL-1β or IL-1Ra.
[0038] In some embodiments, the inhibitor does not substantially induce IL-6 expression
when contacted to IL-1β responsive human cells. Generally, the inhibitor inhibits
signaling by IL-1β, e.g., with an IC50 of less than 100, 50, 20, 10, or 5 nM.
[0039] In some embodiments, the cytokine domain includes one, two, three or more of the
following sequences: WDVNQKTFYLRNNQLVAGYLQGPNV (SEQ ID NO:9); NLEEK (SEQ ID NO:10);
RIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEK(SEQ ID NO:11); AMEADQP(SEQ ID NO:12); FLCTAMEADQPVSLTNMPDEGVMVTKFY(SEQ
ID NO:13); and/or sequences at least 80, 85, 88, 90, 92, 95, 98, or 100% identical
to the foregoing. In some embodiments, the cytokine domain includes one, two, three
or more of the following sequences: VQGEESNDKI (SEQ ID NO:14); KKKMEKRF (SEQ ID NO:15);
and FSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKN YPKKKMEKRFVFNKIEINNKLEFES (SEQ
ID NO:16); and/or sequences at least 80, 85, 88, 90, 92, 95, 98, or 100% identical
to the foregoing. The inhibitor can include other features described herein.
[0040] In an embodiment, the isolated protein includes an amino acid sequence at least 80,
82, 85, 87, 88, 89% identical to the amino acid sequence of P01, P02, P03, P04, or
P05; in such embodiments, the amino acid sequence includes at least one substitution,
insertion, or deletion; in such embodiments, the amino acid sequence can include fewer
than 15, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, or 2 non-conservative substitutions or fewer
than 15, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, or 2 total substitutions; in such embodiments,
the amino acid sequence can include at least 1, 2, 3, 4, or 5 substitutions, e.g.,
conservative substitutions.
[0041] In an embodiment are isolated proteins that include an amino acid sequence at least
80, 82, 85, 87, 88, 89% identical to the amino acid sequence of P01, P02, P03, P04,
or P05 and that include a methionine N-terminal to the amino acid sequence of P01,
P02, P03, P04, or P05; and isolated proteins that include an amino acid sequence at
least 80, 82, 85, 87, 88, 89% identical to the amino acid sequence of P01, P02, P03,
P04, or P05 in which the alanine at N-terminus is absent. The foregoing sequences
can include other features disclosed herein. For example, the sequence can further
include a tag, such as a hexa-histidine sequence, e.g., N- or C-terminal relative
to the IL-1RI binding sequence. The sequence can further include a moiety that modifies
the stability or pharmacokinetics of the IL-1RI binding sequence. For the sequence
can further include a serum albumin and/or an Fc domain, or one or more domains thereof,
e.g., one or more immunoglobulin constant domains or one or more albumin domains.
[0042] In still another aspect, the invention provides an isolated protein as defined in
the appended claims that includes a domain having a circularly permuted form of a
cytokine domain as defined in the claims. The protein can further include a heterologous
sequence (such as an Fc domain or albumin) at the N- or C-terminus of the permuted
form, optionally spaced by a linker.
[0043] The invention also features pharmaceutical compositions as defined by the claims
The compositions can be ophthalmic pharmaceutical compositions, topical compositions,
or compositions for parenteral administration.
[0044] Disclosed but not claimed is a method of modulating an immune or inflammatory response
in a subject; the method can include administering a composition that includes a receptor
binding agent described herein to a subject in an amount effective to modulate the
immune or inflammatory response in the subject.
[0045] The invention provides a pharmaceutical composition as defined in the claims for
use as a medicament, and for use in treating cancer.
[0046] Also disclosed but not claimed is a method of treating an IL-1 mediated disorder
in a subject. The method includes administering a composition that includes a protein
that can bind to IL-1RI, e.g., a receptor binding agent described herein, to the subject.
For example, the disorder can be an autoimmune disorder, e.g., rheumatoid arthritis
or juvenile chronic arthritis, scleroderma, Sjögren's syndrome, ankylosing spondylitis,
Behcet's syndrome, an inflammatory bowel disease, asthma, vasculitis, or psoriasis.
The disorder can be a disorder associated with aggregate formation, e.g., hyperuricemia,
gout, diabetes (including non-insulin dependent diabetes), Alzheimer's disease, secondary
reactive amyloidosis, amyotrophic lateral sclerosis (ALS), Huntington's disease, or
Parkinson's disease. The disorder can also be a CAPS (CIAS1 Associated Periodic Syndromes)
disorder or other disorder described herein.
[0047] The invention provides a pharmaceutical composition as defined in the claims which
is an ophthalmic pharmaceutical composition. Also disclosed but not claimed is a method
of treating an IL-1 mediated ocular disorder in a subject. The method can include
administering a composition that includes a protein that can bind to IL-1RI, e.g.,
a receptor binding agent described herein, to the subject. For example, the composition
is an ophthalmic composition that is administered topically to an eye of the subject
or surrounding region, for example where the disorder is a dry eye disorder; or where
the subject does not exhibit manifestations of systemic autoimmune disease; or where
the subject has Sjögren's syndrome; or where the subject has graft-versus-host disease
(GVHD); or where the disorder is uveitis.
[0048] Also disclosed but not claimed is a method of inhibiting IL-1 activity. The method
includes contacting a receptor binding agent that can bind to IL-1RI to cells responsive
to IL-1 or to a subject. Generally, the protein is provided in an amount effective
to inhibit IL-1 activity associated with the cells or in the subject. The protein
can be contacted to cells from a subject ex vivo.
[0049] In another aspect, this disclosure features an isolated nucleic acid as defined in
the appended claims
[0050] Also featured is a recombinant host cell as defined in the appended claims. A receptor
binding agent can be produced by a not claimed method that includes maintaining the
host cell under conditions that permit expression of the receptor binding agent, and
optionally recovering the receptor binding agent, e.g., from cells or media associated
with the host cell. For example, the receptor binding agent can be purified from lysate
from the cells. The purified receptor binding agent can be formulated, e.g., with
one or more of an excipient, a stabilizer, and a buffer.
[0051] Also disclosed but not claimed is a method of providing a chimeric protein domain.
The method includes identifying at least two parental proteins having a common fold
(e.g., a first parental protein and a second parental protein), locating at least
two segments within the first parental protein and constructing a nucleic acid that
has a sequence encoding a chimeric amino acid sequence that includes the two segments
from the first parental protein and residues that are predominantly from the second
parental protein at remaining positions. The domain can be a domain that is largely
composed of β-sheets, or a domain that is largely composed of α-helices, or a domain
that has a combination of such elements. For example, the domain can have the fold
of a cytokine. The first and second parental proteins can be related by homology,
e.g., between 10-40% amino acid identity. The segments from the first protein are
located within a single folded protein domain, and the chimeric amino acid sequence
includes a form of the folded protein domain that is non-identical to the corresponding
domain in the first and second parental protein. The two parental protein have different
functional properties, and the chimeric domain can have properties of one or both
of the parental proteins. The chimeric domain has one binding interface from the first
parental protein, and another binding interface from the second parental protein.
[0052] Reference is made herein to various regions, segments, and residues in IL-1 family
cytokines in relation to Sites A, B, C, and D. The location of such residues, segments,
and regions in the sequence of human IL-1β (SEQ ID NO:1) and corresponding positions
are provided below and in Fig. 1:
Site A. Site A residues in IL-1β include: ARG11, SER13, GLN14, GLN15, SER21, GLU25, LYS27,
LEU29, HIS30, LEU31, GLN32, GLY33, GLN34, ASP35, MET36, GLU128, ASN129, and MET130,
and corresponding residues of other IL1 cytokine family members (referred to herein
as "Site A residues"). In certain contexts, particularly in connection with IL-1β,
reference is made to "extended Site A residues" which include Site A residues as well
as GLN149, and PHE150, and corresponding residues of other IL1 cytokine family members.
In addition, it is possible to define a "Site A region" as shown in Fig. 4, including
for example an A1 segment (corresponding in IL-1β to 11-36 of SEQ ID NO:1) and an
A2 segment (corresponding in IL-1β to 125-131 of SEQ ID NO:1), and corresponding segments
in other IL1 cytokine family members.
Site B. Site B residues in IL-1β include: ALA1, PRO2, ARG4, GLN48, GLU51, ASN53, ILE56, LYS92,
LYS93, LYS94, LYS103, GLU105, and ASN108, and corresponding residues of other IL1
cytokine family members (referred to herein as "Site B residues"). In certain contexts,
particularly in connection with IL-1β, reference is made to "extended Site B residues"
which include Site B residues as well as PHE46 and SER152 which are outside the Site
B region in Fig. 4. In addition, it is possible to define a "Site B region" as shown
in Fig. 4, including for example a B1 segment (corresponding in IL-1β to 1-5 of SEQ
ID NO:1), a B2 segment (corresponding in IL-1β to 48-56 of SEQ ID NO:1), and a B3
segment (corresponding in IL-1β to 92-98 of SEQ ID NO:1), and corresponding segments
in other IL1 cytokine family members.
Site C. Site C residues in IL-1β include: ILE104, ILE106, ASN107, LYS109, GLU111, THR137,
LYS138, GLY139, GLY140, GLN141, THR144, and ASP145 and corresponding residues of other
IL1 cytokine family members (referred to herein as "Site C residues"). In addition,
it is possible to define a "Site C region" as shown in Fig. 4, including for example
a C1 segment (corresponding in IL-1β to 136-145 of SEQ ID NO:1), and corresponding
segments in other IL1 cytokine family members.
Site D. Site D residues in IL-1β include: LEU6, THR9, LYS63, GLU64, LYS65, and ASN66 and
corresponding residues of other IL1 cytokine family members (referred to herein as
"Site D residues"). In addition, it is possible to define a "Site D region" as shown
in Fig. 4, including, for example, a D1 segment (corresponding in IL-1β to 6-9 of
SEQ ID NO:1), a D2 segment (corresponding in IL-1β to 37-41 of SEQ ID NO:1), and a
D3 segment (corresponding in IL-1β to 63-66 of SEQ ID NO:1), a D4 segment (corresponding
in IL-1β to 86-91 of SEQ ID NO:1), and a D5 segment (corresponding in IL-1β to 150-153
of SEQ ID NO:1) and corresponding segments in other IL1 cytokine family members.
[0053] Further identification of the location of residues and regions for Sites A, B, C,
and D can be found by alignment of the cytokine in question to the sequences shown
in FIG. 4.
[0054] The amino acid sequence of IL-1β (human) as referenced herein is:

[0055] The amino acid sequence of IL-1α (human) as referenced herein is:

[0056] The amino acid sequence of IL-1 Ra (human) as referenced herein is: RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGK
MCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEAD QPVSLTNMPDEGVMVTKFYFQED
(SEQ ID NO:3). The terms IL-1β, IL-1α, and IL-1Ra as used herein refer to the respective
mature proteins.
[0057] The β sheets referenced herein and shown in FIG. 4 refer to the following sequences:
Table 1
| Sheet |
IL-1β (SEQ ID NO:1) |
IL-1Ra (SEQ ID NO:3) |
Loop |
IL-1β (SEQ ID NO:1) |
IL-1Rα (SEQ ID NO:3) |
| β1 |
6-12 |
11-17 |
β1β2 |
13-17 |
18-22 |
| β2 |
18-21 |
23-26 |
β2β3 |
22-24 |
27-28 |
| β3 |
25-28 |
29-32 |
β3β4 |
29-41 |
33-45 |
| β4 |
42-46 |
46-50 |
β4β5 |
47-56 |
51-54 |
| β5 |
57-62 |
55-60 |
β5β6 |
63-66 |
61-64 |
| β6 |
67-70 |
65-68 |
β6β7 |
71-80 |
69-78 |
| β7 |
81-83 |
79-81 |
β7β8 |
84-99 |
82-98 |
| β8 |
100-105 |
99-104 |
β8β9 |
106-109 |
105-108 |
| β9 |
110-114 |
109-113 |
β9β10 |
115-120 |
114-119 |
| β10 |
121-123 |
120-122 |
β10β11 |
124-130 |
123-129 |
| β11 |
131-135 |
130-134 |
β11β12 |
136-145 |
135-145 |
| β12 |
146-150 |
146-150 |
|
|
|
[0058] Calculations of "homology" or "sequence identity" between two sequences (the terms
are used interchangeably herein) are performed as follows. The sequences are aligned
according to the alignments provided herein, or, in the absence of an appropriate
alignment, the optimal alignment determined as the best score using the Needleman
and Wunsch algorithm as implemented in the Needle algorithm of the EMBOSS package
using a Blosum 62 scoring matrix with a gap penalty of 10, and a gap extend penalty
of 1. See
Needleman, S. B. and Wunsch, C. D. (1970) J. Mol. Biol. 48, 443-453;
Kruskal, J. B. (1983) An overview of sequence comparison In D. Sankoff and J. B. Kruskal,
(ed.), Time warps, string edits and macromolecules: the theory and practice of sequence
comparison, pp. 1-44 Addison Wesley, and tools available from the
European Bioinformatics Institute (Cambridge UK)EMBOSS: The European Molecular Biology
Open Software Suite (2000),
Rice, P. et al., A.,Trends in Genetics 16, (6) pp. 276--277 and available online at http://www.ebi.ac.uk/Tools/emboss/ align/index.html and http://emboss.open-bio.org/wiki/Appdoc:Needle.
The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide
positions are then compared. When a position in the first sequence is occupied by
the same amino acid residue or nucleotide as the corresponding position in the second
sequence, then the molecules are identical at that position (as used herein amino
acid or nucleic acid "identity" is equivalent to amino acid or nucleic acid "homology").
The percent identity between the two sequences is a function of the number of identical
positions shared by the sequences. To determine collective identity of one sequence
of interest to a group of reference sequences, a position is considered to be identical
if it is identical to at least one amino acid at a corresponding position in any one
or more of the group of reference sequences. With respect to lists of segments, features,
or regions, identity can be calculated collectively for all members of such list to
arrive an overall percentage identity.
[0059] As used herein, the term "corresponding to" is used to designate the position of
an amino acid residue in a polypeptide of interest with respect to a reference polypeptide.
In the appended claims, corresponding segments and corresponding residues are as indicated
by the alignment provided in Fig. 4.
[0060] As used herein, the term "hybridizes under high stringency conditions" describes
conditions for hybridization and washing. Guidance for performing hybridization reactions
can be found in
Current Protocols in Molecular Biology, John Wiley & Sons, N. Y. (1989), 6.3.1-6.3.6. Aqueous and nonaqueous methods are described in that reference and either can be
used. High stringency hybridization conditions include hybridization in 6X SSC at
about 45°C, followed by one or more washes in 0.2X SSC, 0.1% SDS at 65°C, or substantially
similar conditions. Provided herein are isolated nucleic acids that contain sequences
that hybridize under high stringency conditions to nucleic acids encoding amino acid
sequences disclosed herein and to the nucleic acids disclosed herein, e.g., in Example
1.
[0061] Naturally occurring proteins referenced herein specifically include the human form
of such protein, and also forms from other mammalian species.
BRIEF DESCRIPTION OF THE DRAWINGS
[0062]
Fic. 1 is a graphic of the structure of P04 as determined from X-ray crystallographic data.
The backbone of residues from IL-1Ra are is shown in black, and the backbone of residues
from IL-1β is shown in gray.
Fic. 2 depicts three views of a model of the P05 protein bound to the extracellular domain
of human IL-1RI. In P05, IL-1Ra residues are depicted in black and IL-1β residues
are depicted in white
Fic. 3 depicts models of chimeric proteins in which IL-1Ra residues are depicted in black
and IL-1β residues are depicted in white. The model depicts the proteins: P01 (Fic.
3A), P03 (FIG. 3B), P04 (FIG. 3C), P05 (Fic. 3D), P07 (Fic. 3E), and P06 (FIG. 3F).
FIG. 4 provides an alignment of several human IL-1 family cytokines: IL-1β (SEQ ID NO:1),
IL-1α (SEQ ID NO:2), IL-1Ra (SEQ ID NO:3), IL-33 (SEQ ID NO:4), IL-36Ra (SEQ ID NO:5),
IL-36α (SEQ ID NO:6), IL-36β (SEQ ID NO:7), and IL-36γ (SEQ ID NO:8). Segments referenced
in the text herein are identified under the alignment. In addition, β-sheets and loops
between such sheets are identified.
Fic. 5A is a listing of the amino acid sequence of P01 (SEQ ID NO:17). Fic. 5B is a listing of the amino acid sequence of P02 (SEQ ID NO:18). Fic. 5C is a listing of the amino acid sequence of P03 (SEQ ID NO:19). Fic. 5D is a listing of the amino acid sequence of P04 (SEQ ID NO:20). FIG. 5E is a listing of the amino acid sequence of P05 (SEQ ID NO:21). Segments from IL-1β
are shown in bold italics. See also Example 1 below.
FIG. 6 is an image of an SDS-PAGE gel showing exemplary samples of protein purified from
E. coli cells expressing receptor binding agents. The 15 and 20 kDa molecular weight markers
are indicated at left. Lanes are as follows: molecular weight marker (lane 1 and 6),
extract (lanes 2 and 7), material purified by cation exchange chromatography (lanes
3 and 8), material additionally purified by anion exchange chromatography (lanes 4
and 9), and reduced samples of such material (lanes 5 and 10). Lanes 2-5 are of P05
purification, and Lanes 6-10 are of P04 purification. See also Example 2.
Fic. 7A is a table and accompanying bar graph showing the ability of the P06, P07, and P01
proteins to agonize signaling relative to IL-1β and a negative control, β-glucuronidase
(GUS) protein. Fic. 7B is a graph depicting antagonism of IL-1β at various IL-1β concentrations by P01.
Fic. 8A is a graph depicting IL-1β antagonism by P03 (hexa-histidine tagged), P04 (hexa-histidine
tagged), P05 (hexa-histidine tagged), and IL-1Ra in the presence of 0.1 ng/ml IL-1β
(human). Fic. 8B is a graph depicting IL-1β antagonism by lysates containing untagged forms of
P01, P02, P03, P04, and P05, and IL-1Ra in the presence of 0.1 ng/ml IL-1β (human)
and using estimates of the concentration of protein in the respective lysates.
FIG. 9 contains graphs of SPR data showing binding kinetics to immobilized soluble IL-1RI
for the following proteins: IL-1β (FIG. 9A), IL-1Ra (FIG. 9B), P04 (FIG. 9C), and P05 (FIG. 9D).
Fic. 10A is a graph depicting thermal denaturation of IL-1Ra, IL-1β, P03, P04, and P05 as
described in Example 7. Fic. 10B depicts the negative first derivative of the graph
in FIG. 10A.
FIG. 11A is a bar graph showing the mean corneal staining score ± SEM as tested by fluorescein
staining of the cornea per eye of two independent studies, on days 0, 3, 7, 9, and
11 for mice in a dry eye model. The mice received no treatment (n = 18), 10 mg/ml
P05 (n=19), or 1.25× PBS, the vehicle (n = 20). Asterisks indicate statistical significance
of P05 relative to vehicle as follows: * (P < 0.05) and ** (P < 0.005).
FIG. 11B is a bar graph representing data from a separate experiment showing mean corneal
staining score ± SEM of the cornea per eye, on days 0, 3, 7, 9, and 11 for mice in
a dry eye model. The mice received no treatment (n = 8), 1.25× PBS vehicle (n =8),
10 mg/ml murine serum albumin (MSA) (n = 8), or 10 mg/ml P05 (n=9). Asterisks indicate
statistical significance of P05 relative to murine serum albumin as follows: * (P
< 0.05) and *** (P < 0.0005).
FIG. 11C is a bar graph including data for mice that were treated with Restasis® (0.05% cyclosporine emulsion) (n = 8) in the same experiment as FIG. 11B. Asterisks
indicate statistical significance of P05 relative to Restasis® as follows: ** (P < 0.005) and *** (P < 0.0005).
Fic. 12A depicts the structure of the X-ray crystallographic structure (black) of P04 overlaid
on a computed model (gray) of its structure. FIG. 12B illustrates interactions between K64 and E39 of P04; FIG. 12C illustrates interactions between the C-terminal residues Q149 and S152 with K40 and
R9 of P04.
DETAILED DESCRIPTION
[0063] The IL-1 family of cytokines includes several members, all having a common β-trefoil
fold comprised of six β-strands that form a β-barrel capped by another six β-strands.
The primary structures of the human and other mammalian forms of these cytokines are
known. An exemplary structural alignment of several human IL-1 family members is shown
in Fig. 1.
[0064] We have discovered,
inter alia, that the IL-1 fold is highly plastic. In particular, elements from different members
can be combined to provide proteins that agonize or antagonize cytokine signaling.
Examples of these proteins include chimeric cytokine domains that include, for example,
two or more segments or surface residues from one cytokine in the context of another
cytokine or a cytokine consensus sequence, thus creating non-naturally occurring combinations
of receptor interaction sites from different IL-1 family cytokines.
[0065] IL-1 family cytokines can include at least two primary receptor interaction sites,
referred to as Site A and Site B. Sites A and B are involved in contacts to the primary
cytokine receptor (e.g., IL-1RI). In the case of IL-1Ra and IL-1β, for example, the
two proteins differ substantially with respect to sites A and B such that IL-1Ra makes
fewer receptor contacts in Site B than Site A.
[0066] We have found that it is possible to construct functional chimeric cytokine domains
that include a Site A derived from one cytokine and a Site B derived from another
cytokine. The plasticity of the IL-1 fold permits construction of a variety of chimeric
cytokine domains to antagonize IL-1 signaling.
[0067] In addition, IL-1 family cytokines can include two secondary receptor interaction
sites, referred to as Site C and Site D, which are involved in agonism and/or antagonism,
and can be determinative of a cytokine's ability to interact with its secondary cytokine
receptor (e.g., IL-1RAcP). Inclusion of Site C and/or Site D residues from natural
receptor antagonists (such as IL-1Ra) can impart antagonistic properties. Chimeric
cytokine domains can be constructed that include one or both of Sites A and B from
one or more IL-1 agonists (such as IL-1β and IL-1α) and/or an IL-1 receptor antagonist
(such as IL-1Ra) and one or both of Sites C and D from an IL-1 receptor antagonist
(such as IL-1Ra). Accordingly, it is possible to produce a chimeric cytokine domain
that antagonizes signaling and that includes Site B residues from an IL-1 agonist.
[0068] Exemplary combinations are also provided in Table 2 below:
Table 2
| |
A |
B |
C |
D |
| 1. |
IL-1β or 1α |
IL-1β or 1α |
IL-1Ra |
IL-1β or 1α |
| 2. |
IL-1β or 1α |
IL-1β or 1α |
IL-1β or 1α |
IL-1Ra |
| 3. |
IL-1β or 1α |
IL-1β or 1α |
IL-1Ra |
IL-1Ra |
| |
| 4. |
IL-1Ra |
IL-1β or 1α |
IL-1Ra |
IL-1β or 1α |
| 5. |
IL-1Ra |
IL-1β or 1α |
IL-1β or 1α |
IL-1Ra |
| 6. |
IL-1Ra |
IL-1β or 1α |
IL-1Ra |
IL-1Ra |
[0069] A chimeric cytokine domain as defined in the accompanying claims can have the ability
to bind an IL-1 family receptor, e.g., human IL-1RI with a K
D of less than 10
-8, 10
-9, or 10
-10, e.g., a K
D within 10 or 100 fold that of a natural receptor ligand (e.g., IL-1β, IL-1α, or IL-1Ra)
under the same conditions or less than that of a natural ligand (e.g., IL-1β, IL-1α,
or IL-1Ra) under the same conditions. Moreover, in certain embodiments, the chimeric
cytokine domain binds with a K
D less than, a K
on faster than, or a K
off slower than at least one of its parental cytokine domains.
[0070] Chimeric cytokine domains as defined in the accompanying claims that bind to IL-1
family receptor and which antagonize receptor signaling can be used as receptor binding
agents, e.g., to treat disorders mediated by IL-1 family cytokine signaling as defined
in the accompanying claims. For example, the isolated protein as defined in the accompanying
claims has an IC
50 of less than 100, 10, 1, 0.6, or 0.3 nM as defined in the accompanying claims.
[0071] In certain embodiments, the cytokine domain can be at least 40, 45, or 50% identical,
but less than completely identical, e.g., less than 95, 90, 85, or 80% identical to
human IL-1β. At the same time, the cytokine domain can also be at least 40, 45, or
50% identical, but less than completely identical, e.g., less than 95, 90, 85, or
80% identical to a human IL-1Ra.
[0072] In some embodiments, at least 80, 85, 90, 92, 94, 95, 97, 98, 99, or 100% of the
positions within the cytokine domain have the property that, at each such position,
the amino acid present is either identical to the first IL-1 family cytokine domain,
wherein the first IL-1 family cytokine is IL-1β, or to the second IL-1 family cytokine
domain wherein the second IL-1 family cytokine is IL-1Ra, (or both if the first and
second IL-1 family cytokine are identical at the particular position). Where 100%
of the amino acid positions in the cytokine domain have this property, the domain
is a complete chimera of two cytokines. Chimeric cytokine domains as defined by the
appended claims can also be made from more than two cytokines and can also have mutations
relative to its parental cytokines (e.g., one or more particular positions where the
amino acid present differs from the corresponding amino acid in each of its parental
cytokines).
[0073] Several residues in IL-1β contact or are in proximity with IL-1RI, for example: ALA1,
PRO2, VAL3, ARG4, LEU6, ARG11, SER13, GLN14, GLN15, GLU25, LYS27, LEU29, HIS30, LEU31,
GLN32, GLY33, GLN34, ASP35, MET36, GLN38, GLN39, PHE46, GLN48, GLU51, SER52, ASN53,
LYS55, ILE56, PRO57, LYS92, LYS93, LYS94, LYS103, GLU105, ASN108, ALA127, GLU128,
ASN129, MET130, GLN141, GLN149, PHE150, and SER152. In addition to the designation
into sites as described above, these residues can be classified into two sets: Set
1 and Set 2.
[0074] Exemplary Set 1 residues in IL-1β include: ARG11, SER13, GLN14, GLN15, GLU25, LYS27,
LEU29, HIS30, LEU31, GLN32, GLY33, GLN34, ASP35, MET36, GLN38, GLN39, ALA127, GLU128,
ASN129, MET130, and GLN141 and corresponding residues in other IL-1 cytokine family
members. Extended Set 1 residues include interaction Set 1 residues and residues within
4 Angstroms of the foregoing in the 1ITB structure. Exemplary Set 2 residues in IL-1β
include: ALA1, PRO2, VAL3, ARG4, LEU6, PHE46, GLN48, GLU51, SER52, ASN53, LYS55, ILE56,
PRO57, LYS92, LYS93, LYS94, LYS103, GLU105, ASN108, GLN149, PHE150, and SER152 and
corresponding residues in other IL-1 cytokine family members. Extended Set 2 residues
include interaction Set 2 residues and residues within 4 Angstroms of the foregoing
in the 1ITB structure. In certain embodiments, a cytokine domain as defined in the
appended claims includes IL-1β residues at at least 15, 16, 17, 18, 19, 20, or 21
of the Set 1 residues identified above. In certain embodiments, a cytokine domain
includes IL-1β residues at at least 15, 16, 17, 18, 19, 20, 21, or 22 of the Set 2
residues identified above. In some embodiments, a cytokine domain as defined in the
appended claims includes IL-1β residues at at least 15, 16, 17, 18, 19, 20, or 21
of the extended Set 1 residues. In some embodiments, a cytokine domain as defined
in the appended claims includes IL-1β residues at at least 15, 16, 17, 18, 19, 20,
or 21 of the extended Set 2 residues.
[0075] In certain embodiments, the cytokine domain as defined in the claims includes at
least 3, 4, 5, 6, 7, or 8 residues identical to IL-1β at positions corresponding to
1-8 of SEQ ID NO:1. For example, it includes residues identical to IL-1β at positions
corresponding to 3, 4, or all 5 of: ALA1, PRO2, VAL3, ARG4, and LEU6.
[0076] In certain embodiments, the cytokine domain as defined in the claims includes at
least 8, 9, 10, 11, 12, 13, 14, 15, 16, or 17 residues identical to IL-1β at positions
corresponding to 45-61 of SEQ ID NO:1. For example, it includes residues identical
to IL-1β at positions corresponding to 3, 4, 5, 6, 7 or 8 of: PHE46, GLN48, GLU51,
SER52, ASN53, LYS55, ILE56, and PRO57.
[0077] In certain embodiments, the cytokine domain as defined in the claims includes at
least 5, 6, 7, 8, 9, or 10 residues identical to IL-1β at positions corresponding
to 86-95 of SEQ ID NO:1. For example, it includes residues identical to IL-1β at positions
corresponding to one, two, or all three of LYS92, LYS93, and LYS94.
[0078] In certain embodiments, the cytokine domain as defined in the claims includes at
least 3, 4, 5, or 6 residues identical to IL-1β at positions corresponding to 148-153
of SEQ ID NO:1. For example, it includes residues identical to IL-1β at positions
corresponding to one, two, or all three of GLN149, PHE150, and SER152.
[0079] In certain embodiments, the cytokine domain does not include a threonine at the position
corresponding to THR147 in IL-1β. For example, this position can be an aromatic, such
as a tyrosine. The aromatic at the position corresponding to THR147 in IL-1β can pack
against another aromatic (e.g., tryptophan) present in several embodiments at position
11 (according to IL-1β numbering).
[0080] In certain embodiments, the cytokine domain does not include an aromatic at the position
corresponding to CYS8 in IL-1β. For example, this position can be an amino acid other
than phenylalanine, or other than an aromatic. For example, it can be cysteine, valine,
serine, threonine or alanine. This position is located near other bulky residues,
particularly MET44 and MET148 (according to IL-1β numbering). Preferably, not all
three of positions 8, 43, and 148 are bulky residues.
[0081] In certain embodiments, the cytokine domain as defined in the claims includes at
least five, six, or seven residues identical to IL-1Ra at positions corresponding
to 30-36 of SEQ ID NO:1, e.g., at least five, six, or seven residues identical to
YLQGPNV (SEQ ID NO:43). For example, the cytokine domain as defined in the claims
includes at least 10, 12, 14, 16, 18, 19, 20, 21, 22, 23, 24, 25, or 26 residues identical
to IL-1Ra at positions corresponding to 11-36 of SEQ ID NO:1. The cytokine domain
can also include a basic residue at the position corresponding to 145 of SEQ ID NO:1.
[0082] In certain embodiments, the cytokine domain includes: (a) glutamic acid at the position
corresponding to Val40 of IL-1β and lysine at the position corresponding to Lys65
of IL-1β; (b) arginine at the position corresponding to Thr9 of IL-1β and glutamine
at the position corresponding to Gln149 of IL-1β; and/or (c) lysine at the position
corresponding to V41 of IL-1β and serine at the position corresponding to Ser152 of
IL-1β.
[0083] The cytokine domain as defined in the claims can also include at least four, five,
six, or seven residues identical to IL-1Ra at positions corresponding to 126-132,
e.g., at least four, five, six, or seven residues identical to MEADQPVS (SEQ ID NO:44).
[0084] In certain embodiments, the cytokine domain as defined in the claims includes at
least 10, 12, 14, 16, 18, 19, 20, 21, 22, 23, or 24 residues identical to IL-1β at
positions corresponding to 62-85 of SEQ ID NO:1.
[0085] In some embodiments, the cytokine domain includes one or more of the following amino
acid sequences (e.g., all four of): RSLAFR (SEQ ID NO:45), IDVSFV (SEQ ID NO:46),
KKMDKR (SEQ ID NO:47), and KFYMQF (SEQ ID NO:48); one or more of the following (e.g.,
all four of) RSLAFR (SEQ ID NO:45), IDVSFV (SEQ ID NO:46), NKLSFE (SEQ ID NO:49),
and KFYMQF (SEQ ID NO:48); one or more of the following (e.g., all four of) RSLAFR
(SEQ ID NO:45), EEKFSM (SEQ ID NO:50), RFVFIR (SEQ ID NO:51), and VTKFTM (SEQ ID NO:52);
one or more of the following (e.g., all four of) RSLAFR (SEQ ID NO:45), EEKFSM (SEQ
ID NO:50), FESAAC (SEQ ID NO:53), and VTKFTM (SEQ ID NO:54); or one or more of the
following (e.g., all four of) LNCRIW (SEQ ID NO:55), EEKFSM (SEQ ID NO:50), PNWFLC
(SEQ ID NO:56), and KFYMQF (SEQ ID NO:48).
[0086] Specific examples of chimeric cytokine domains that are based on IL-1β and IL-Ra
are provided in Example 1 below and include the following exemplary cytokine domains
that antagonize IL-1 signaling:
P01. The P01 domain includes three segments from IL-1Ra corresponding to amino acids Ala12-Val48,
Ile60-Val83, and Asp95-Tyr147 of SEQ ID NO:3, and the remaining four segments from
IL-1β. Overall, the P01 domain has 74 of 153 amino acids from IL-1β (about 48% identity)
and 119 amino acids from IL-1Ra (about 77% identity). These percentages add up to
greater than 100% because a number of amino acids in P01 and other exemplary proteins
disclosed herein are amino acids that are conserved between IL-1β and IL-1Ra and accordingly
contribute to the percentage identity for both IL-1β and IL-1Ra.
P02. The P02 domain includes three segments from IL-1Ra corresponding to amino acids Ala12-Val48,
Ile60-Val83, and Ser110-Tyr147 of SEQ ID NO:3, and the remaining four segments from
IL-1β. Overall, the P02 domain has 85 of 153 amino acids from IL-1β (about 55% identity)
and 108 amino acids from IL-1Ra (about 70% identity).
P03. The P03 domain includes two segments from IL-1Ra corresponding to amino acids Ala12-Lys45
and Phe100-Lys145 of SEQ ID NO:3, and the remaining three segments from IL-1β. Overall,
the P03 domain has 94 of 153 amino acids from IL-1β (about 61% identity) and 91 amino
acids from IL-1Ra (about 64% identity).
P04. The P04 domain includes two segments from IL-1Ra corresponding to amino acids Ala12-Lys45
and Ala114-Lys145 of SEQ ID NO:3, and the remaining three segments from IL-1β. Overall,
the P04 domain has 104 of 153 amino acids from IL-1β (about 68% identity) and 89 amino
acids from IL-1Ra (about 58% identity).
P05. The P05 domain includes two segments from IL-1Ra corresponding to amino acids Arg14-Lys45
and Phe120-Tyr147 of SEQ ID NO:3, and the remaining three segments from IL-1β. Overall,
the P05 domain has 108 of 153 amino acids from IL-1β (about 70% identity) and 85 amino
acids from IL-1Ra (about 55% identity).
[0087] Other chimeric proteins can be similarly constructed. For example, chimeric proteins
can be made between IL-1α and IL-1Ra, e.g., specifically domains including the identified
segments of IL-1Ra in combination with corresponding residues from IL-1α rather than
IL-1β for each of the above examples, but that is not claimed.
Protein Modifications and Substitutions
[0088] Protein sequences, such as those described herein, can be varied, e.g., by making
one or more conservative substitutions. Conservative substitutions can be made to
retain function or to make modest changes in function. Exemplary conservative substitutions
are described in the following table:
Table 3
| Original |
Exemplary Substitutions |
Further Specific Substitutions |
| Ala (A) |
val; leu; ile |
val |
| Arg (R) |
lys; gln; asn |
lys |
| Asn (N) |
gln; his; lys; arg |
gln |
| Asp (D) |
glu |
glu |
| Cys (C) |
ser |
ser |
| Gln (Q) |
asn |
asn |
| Glu (E) |
asp |
asp |
| Gly (G) |
pro; ala |
ala |
| His (H) |
asn; gln; lys; arg |
arg |
| Ile (I) |
leu; val; met; ala; phe; leu |
leu |
| Leu (L) |
norleucine; ile; val; met; ala; phe |
ile |
| Lys (K) |
arg; gln; asn |
arg |
| Met (M) |
leu; phe; ile |
leu |
| Phe (F) |
leu; val; ile; ala; tyr |
leu |
| Pro (P) |
ala |
ala |
| Ser (S) |
thr |
thr |
| Thr (T) |
ser |
ser |
| Trp (W) |
tyr; phe |
tyr |
| Tyr (Y) |
trp; phe; thr; ser |
phe |
| Val (V) |
ile; leu; met; phe; leu; norleucine |
ala |
[0089] Substitutions can be chosen based on their potential effect on (a) backbone structure
in the vicinity of the substitution, for example, a sheet or helical conformation,
(b) the charge or hydrophobicity of the molecule at the target site, or (c) the volume
and branching of the side chain. Amino acid residues can be classified based on side-chain
properties: (1) hydrophobic: norleucine, met, ala, val, leu, ile;(2) neutral hydrophilic:
cys, ser, thr; asn; gln; (3) acidic: asp, glu; (4) basic: his, lys, arg; (5) residues
that affect backbone conformation: gly, pro; and (6) aromatic: trp, tyr, phe.
[0090] Non-conservative substitutions can include substituting a member of one of these
classes for a member of a different class. Conservative substitutions can include
substituting a member of one of these classes for another member of the same class.
[0091] The significance of a particular residue can also be evaluated in the context of
the hydropathic index for the amino acid. Each amino acid has been assigned a hydropathic
index on the basis of its hydrophobicity and charge characteristics: isoleucine (+4.5);
valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine (+2.5); methionine (+1.9);
alanine (+1.8); glycine (-0.4); threonine (-0.7); serine (-0.8); tryptophan (-0.9);
tyrosine (-1.3); proline (-1.6); histidine (-3.2); glutamate (-3.5); glutamine (-3.5);
aspartate (-3.5); asparagine (-3.5); lysine (-3.9); and arginine (-4.5). For a discussion
of the hydropathic amino acid index and its significance see, for example,
Kyte et al., 1982, J. Mol. Biol. 157:105-131.
[0092] The sequence of a protein can be varied by any method, including oligonucleotide-mediated
(site-directed) mutagenesis, (
Carter et al., Nucl. Acids Res.,13:4331, 1986;
Zoller et al., Nucl. Acids Res., 10:6487, 1987), cassette mutagenesis (
Wells et al., Gene, 34:315, 1985), restriction selection mutagenesis (
Wells et al., Philos. Trans. R. Soc. London, 317:415, 1986), and PCR mutagenesis. See also In
Vitro Mutagenesis Protocols: Third Edition, Braman (ed.), Humana Press, (2010) ISBN:
1607616513 and
PCR Cloning Protocols: From Molecular Cloning to Genetic Engineering, Chen and Janes
(ed.), Humana Press, (2002) ISBN: 0896039730.
[0093] Scanning amino acid analysis can be employed to evaluate one or more amino acids
along a contiguous sequence. The method can involve mutating each or nearly each amino
acid in a region to a particular amino acid, e.g., to a relatively small, neutral
amino acid such as alanine, serine, or valine. Alanine is typically chosen because
it eliminates the side-chain beyond the beta-carbon and is less likely to alter the
main-chain conformation of the variant (
Cunningham and Wells, Science, 244: 1081-1085, 1989). It is also the most common amino acid and is frequently found in both buried and
exposed positions (
Creighton, The Proteins, (W. H. Freeman & Co., N.Y.);
Chothia, J. Mol. Biol., 150:1, 1976). The scanning process can also be adapted to make more marked changes, e.g., charged
residues can be changed to residues of the opposite charge, residues with short side
chains can be replaced with ones with bulk side chains. For example, arginine scanning
is an approach that can be used instead of or in addition to alanine scanning. The
scanning can be applied to each residue in a region or to residues of a particular
property, e.g., residues at or near the surface of a protein or likely to be at or
near the surface of the protein.
[0094] The structure of a protein, one of its domains, or a complex involving the protein
can be modeled, e.g., by performing homology based modeling, energy minimization and/or
other modeling using known solved structures. Such methods include: Accelrys Software
Inc., Discovery Studio
®, Release 3.0 , San Diego: Accelrys Software Inc., 2010, AMBER
™ modeling software (
Case et al. (2005) J. Computat. Chem. 26, 1668-1688 and
Case et al. (2010), AMBER 11, University of California, San Francisco, CA USA) and CHARMM
™ modeling software (Molecular Simulations Inc.). See also generally
Baker and Sali, Science 294(5540):93-6, 2001). The structure can also be determined directly, e.g., using X-ray crystallography
and/or NMR spectroscopy.
[0095] Exemplary PDB structures describing the structure of IL-1 family cytokines include:
1I1B, 1ILR, 1IRA, 1ITB, 2I1B, 2ILA, 2KLL, 4I1B, 5I1B, 6I1B, 7I1B, 8I1B, 9ILB, and
1MD6 (available by http from www.pdb.org from RCSB-Rutgers, Piscataway NJ, USA, and
from the National Library of Medicine (Bethesda, MD, USA)). For example, the structures
of IL-1β alone and in complex with the receptor IL-1RI have been solved. See e.g.,
Finzel et al. (1989) J. Mol. Biol. 209: 779-791, PDB 1ITB, and
Vigers et al. (1997) Nature 386: 190-194. The structure of IL-1Ra with IL-1RI has also been solved. See, e.g., PDB 1IRA and
Schreuder et al., (1997) Nature 386: 194-200.
[0096] Homology modeling can be assisted by alignment of sequences, e.g., using computer
software such as Basic Local Alignment Search Tool (BLAST), PSI-BLAST, PHI-BLAST,
WU-BLAST-2, and/or MEGABLAST. See
Altschul et al., 1990, J. Mol. Biol. 215, 403-410;
Altschul et al., 1996, Methods in Enzymology 266, 460-480; and
Karlin et al., 1993, PNAS USA 90, 5873-5787. Additional algorithms for aligning macromolecules (amino acid sequences and nucleic
acid sequences) include FASTA (
Pearson, 1995, Protein Science 4, 1145-1160), ClustalW (
Higgin et al., 1996, Methods Enzymol. 266, 383-402), DbClustal (
Thompson et al., 2000, Nucl. Acids Res. 28, 2910-2926), and the Molecular Operating Environment (Chemical Computing Group, Montreal, Quebec
Canada H3A 2R7). In addition, the algorithm of Myers and Miller (
Myers & Miller, CABIOS 4, 11-17, 1988) which is incorporated into the ALIGN program (version 2.0) of the GCG sequence alignment
software package can be used.
[0097] A consensus sequence for IL-1β and IL-1Ra can be obtained by comparing the two sequences
and identifying residues that are identical or that are highly conserved. An exemplary
consensus sequences is: DXXQKX
{8-9}L-AXXLQGX
{18-28}LGX
{7}LSCVXXXDXXXLQLEXVX
{8-9}KXXKRFXFX
{10}FESAXXPXWXXXTXXXXXXPVXLX
{5-6}GXXXTXFXXQ (SEQ ID NO:57), where X is independently any amino acid and the subscripted
number or range is the number of occurrences. Other consensus sequences can be identified
in like manner.
[0098] Further variants of an IL-1 cytokine family member can be made and evaluated using
a display-based system or other library based screening. For example, the protein
variants can be displayed or expressed and evaluated for ability to bind to a receptor
for the IL-1 cytokine family member. For example, variants of IL-1β, IL-1Ra, or a
cytokine domain described herein can be evaluated for ability to bind to the soluble
extracellular domain of IL-1RI. A general description of display-based systems include
the following: for cell display,
Chao et al. Nat Protoc. 2006;1(2):755-68;
Colby et al. Methods Enzymol. 2004;388:348-58;
Boder et al., Methods Enzymol. 2000;328:430-44), for phage display (e.g.,
Viti et al., Methods Enzymol. 2000;326:480-505 and
Smith (1985) Science 228:1315-1317), and for ribosome display (e.g.,
Mattheakis et al. (1994) Proc. Natl. Acad. Sci. USA 91:9022 and
Hanes et al. (2000) Nat Biotechnol. 18:1287-92;
Hanes et al. (2000) Methods Enzymol. 328:404-30; and
Schaffitzel et al. (1999) J Immunol Methods. 231(1-2):119-3.
[0099] IL-1 cytokines, e.g., from other species, are known and available and can be found
in public databases such as Entrez (the National Library of Medicine, Bethesda MD)
and EBI-EMBL (Hinxton, Cambridge UK). Examples of such sequences from the UNIPROT
database (available at UniProt.org and see
The UniProt Consortium, Nucleic Acids Res. D142-D148 (2010)), include the following:
| Protein |
Accession Numbers |
| IL-1α |
P01583, P01582, P16598, P08831, Q28385, Q28579, 046612, P48089, P18430, P04822, P46647,
046613, Q3HWU1, P79161, Q60480, P79340 |
| IL-1β |
P01584, P10749, Q28386, P09428, P14628, P21621, Q63264, P41687, P48090, Q9YGD3, P26889,
Q2MH07, Q28292, Q9WVG1, P46648, P79182, P51493, Q865X8 |
| IL-1Ra |
P18510, P25085, 018999, P26890, P25086, Q9GMZ4, Q9BEH0, O77482, Q866R8, Q29056 |
| IL-1Rl |
Q02955, P14778, P13504 |
| IL-1RAcP |
Q9NPH3, Q61730, P59822, Q63621 |
[0100] Cytokine domains as defined in the claims can also include substitutions present
in variant cytokine domains that are able to bind to IL-1RI. For example, position
15 of SEQ ID NO:1 (corresponding to position 20 of SEQ ID NO:3) can be Met or Asn.
Position 30 of SEQ ID NO:1 (corresponding to position 34 of SEQ ID NO:3) can be Gly,
His, Trp, or Met.
[0101] Additional exemplary variants of IL-1β and IL-1Ra include those described in
Boraschi et al. (1996) Frontiers in Bioscience: A Journal and Virtual Library 1, d270-308,
Evans et al., J. Biol. Chem., 270:11477 (1995) and
Greenfeder et al., J. Biol. Chem., 270:22460 (1995). For example, variants of IL-1β include R11G, R11A, Q15H, E105G, and T147G. See,
e.g., Evans et al. Variants of IL-1Ra include W16Y, Q20M, Q20N, Y34G, Y34H, Y34W,
Y34M, Y147G, Y147H, Y147M, K145D, H54P, V18S, T108K, C116F, C122S, C122A, Y147G, H54P,
H54I, and others in
Evans et al. and Greenfeder et al., J. Biol. Chem., 270:22460 (1995). A cytokine domain as defined in the claims can include a residue identical to IL-1Ra
at one of the foregoing positions. A cytokine domain as defined in the claims can
also include a residue differing from one of the foregoing mutations at a corresponding
position.
[0102] In addition, IL-1 family cytokines can include one or more unpaired cysteine residues.
One or more, e.g., two, three or all such unpaired cysteine residues can be mutated
to another amino acid, e.g., an uncharged amino acid such as alanine or serine. For
example, P01 includes cysteines at positions 67, 70, 116, and 122 of SEQ ID NO:17.
One, two, three or all four such cysteines can be substituted with another amino acid,
e.g., an uncharged amino acid such as alanine or serine. P02 includes cysteines at
positions 67, 70, 116, and 122 of SEQ ID NO:18. One, two, three, or all four such
cysteines can be substituted with another amino acid, e.g., an uncharged amino acid
such as alanine or serine. P03 includes cysteines at positions 70, 116, and 122 of
SEQ ID NO:19. One, two, or all three such cysteines can be substituted with another
amino acid, e.g., an uncharged amino acid such as alanine or serine. P04 includes
cysteines at positions 70, 116, and 122 of SEQ ID NO:20. One, two, or all three such
cysteines can be substituted with another amino acid, e.g., an uncharged amino acid
such as alanine or serine. P05 includes cysteines at positions 8, 70, and 122 of SEQ
ID NO:21. One, two, or all three such cysteines can be substituted with another amino
acid, e.g., an uncharged amino acid such as alanine or serine.
[0103] An IL-1 family cytokine domain, including the chimeric cytokine domains described
herein, can also be cyclically permutated. For example, a C-terminal segment from
the domain can be repositioned so that it is N-terminal to the original N-terminus
and an N-terminal segment (generally comprising the remainder of the original protein
after excision of the C-terminal segment). The two repositioned segments can be separated
by a linker (e.g., of between about three to ten amino acids). Generally, all the
amino acids in the domain prior to permutation are retained except for the change
in order. The cut point for the permutation can be in a flexible region, e.g., a flexible
loop such as such as the β6-β7 (e.g., amino acids corresponding to 71-80 of SEQ ID
NO:3) or the β7-β8 loop (e.g., amino acids corresponding to 84-99 of SEQ ID NO:3).
[0104] In some embodiments, the isolated protein defined by the claims has a molecular weight
less than 30, 25, 22, 20, 19, 18, or about 17 kDa. In some embodiments, the receptor
binding agent has a molecular weight greater than 18, 19, 20, 22, 25, 30, 40, 45,
or 50 kDa. For example, the isolated protein defined by the claims can include other
polypeptide, polymeric or non-polymeric components, for example, components which
modify the agents pharmacokinetics, stability, immunogenicity, and/or molecular weight.
The protein defined by the claims may include other modifications, e.g., post-translational
or synthetic modifications. In certain embodiments, the isolated protein defined by
the claims is not glycosylated. In other embodiments, the isolated protein defined
by the claims includes at least one glycosylation.
[0105] For example, the isolated protein defined by the claims can include additional domains
and features. For example, the isolated protein defined by the claims can be fused,
directly or indirectly, to a domain of an antibody protein, e.g., to an Fc domain
or to one or more constant domains (e.g., CH1, CH2, or CH3). For example, the domains
can be human domains or variants of human domains. The Fc domain or the one or more
constant domains can be located N-terminal or C-terminal to the receptor binding agent.
[0106] Fc domains can be obtained from any suitable immunoglobulin, e.g., from a human antibody,
e.g., such as an antibody of the IgG1, IgG2, IgG3, or IgG4 subtypes, IgA, IgE, IgD
or IgM. In one example, the Fc domain includes a sequence from an amino acid residue
at about position Cys226, or from about position Pro230, to the carboxyl terminus
of the Fc domain. An Fc domain generally includes two constant domains, a CH2 domain
and a CH3 domain, and optionally includes a CH4 domain. Antibodies with substitutions
in an Fc region thereof and increased serum half- lives are also described in
WO00/42072,
WO 02/060919;
Shields et al., J. Biol. Chem. 276:6591-6604 (2001);
Hinton, J. Biol. Chem. 279:6213-6216 (2004)). Numbering of the residues in an IgG heavy chain is that of the EU index as in
Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health
Service, NH1, MD (1991) with reference to the numbering of the human IgG1 EU antibody therein.
[0107] In one embodiment, the isolated protein defined by the claims includes a salvage
receptor-binding epitope which increases in vivo serum half-life, as described, e.g.,
in
US Patent 5,739,277 and
Ghetie et al., Ann. Rev. Immunol. 18:739-766 (2000)). In some embodiments, the epitope is included in an Fc region that is fused to
the receptor binding agent.
[0108] In one embodiment, the isolated protein defined by the claims includes a serum albumin
sequence, or a portion of such sequence that binds to the FcRn receptor, or a sequence
which binds to serum albumin, e.g., human serum albumin. For example, certain peptides
bind to serum albumin can be associated with the receptor binding agent, e.g., the
sequence DICLPRWGCLW (SEQ ID NO:22). See also,
Dennis et al. J. Biol. Chem. 277:35035-35043 (2002).
[0109] The isolated protein defined by the claims can be modified to include a sequence
that increases the size and stability of the agent, e.g., a sequence described in
WO2008/155134 or
WO2009/023270. Such sequences can be generally biologically inactive, e.g., it does not modulate
signaling mediated by IL-1 cytokine family members. A variety of stabilizing polypeptide
sequences can be used, e.g., sequences rich in glycine and/or serine, as well as other
amino acids such as glutamate, aspartate, alanine or proline. For example, sequences
can be designed to have at least 30, 40, 50, 60, 70, 80, 90 or 100% glycine and/or
serine residues. In some embodiments, the combined length of stabilizing polypeptide
sequences that are attached to a protein can be at least 20, 25, 35, 50, 60, 70, 80,
90, 100, 120, 140, 160, 180, 200, 250, 300, 350, 400, 500, 600, 700, 800, 900 or more
than 1000 or 2000 amino acids. Stabilizing sequences can be, for example, fused to
a biologically active polypeptide, for example to the Nor C-terminus of the receptor
binding agent. Fusion of stabilizing sequences can result in a significant increase
in the hydrodynamic radius of the fusion protein relative to the unmodified protein,
which can be detected by ultracentrifugation, size exclusion chromatography, or light
scattering, for example. In some embodiments, stabilizing sequences to contain few
or none of the following amino acids: cysteine (to avoid disulfide formation and oxidation),
methionine (to avoid oxidation), asparagine and glutamine (to avoid desamidation)
and aspartate. Stabilizing sequences can be designed to contain proline residues that
tend to reduce sensitivity to proteolytic degradation.
Binding Assays
[0110] The interaction of a receptor binding agent and its targets can be analyzed using
any suitable approach, including for example radio-immunoassays, cell binding assays,
and surface plasmon resonance (SPR). An exemplary cell binding assay using radio-iodinated
protein competition is described in
Boraschi, J. Immunol., 155(10):4719-25 (1995).
[0111] SPR or Biomolecular Interaction Analysis (BIA) can detect biospecific interactions
in real time and without labeling any of the interactants. Changes in the mass at
the binding surface (indicative of a binding event) of the BIA chip result in alterations
of the refractive index of light near the surface (the optical phenomenon of surface
plasmon resonance (SPR)). The changes in the refractivity generate a detectable signal,
which are measured as an indication of real-time reactions between biological molecules.
Methods for using SPR are described, for example, in
Raether, 1988, Surface Plasmons Springer Verlag;
Sjolander and Urbaniczky, 1991, Anal. Chem. 63:2338-2345;
Szabo et al., 1995, Curr. Opin. Struct. Biol. 5:699-705 and on-line resources provide by BIAcore International AB (Uppsala, Sweden). A BIACORE
® system or a Reichert SR7000DC Dual Channel SPR can be used to compare and rank interactions
in real time, in terms of kinetics, affinity or specificity without the use of labels.
Binding affinities of a receptor binding agent for a cytokine receptor extracellular
domain (e.g., the extracellular domain of IL-1RI) can be measured using SPR under
approximately physiological conditions, e.g., 10 mM HEPES pH 7.4, 150 mM NaCl, 3 mM
EDTA, 0.005% Tween-20. Other methods that do not rely on SPR can also be used, e.g.,
to measure binding and affinity.
[0112] Information from binding assays can be used to provide an accurate and quantitative
measure of the equilibrium dissociation constant (K
D), and kinetic parameters (e.g., K
on and K
off) for the binding of a receptor binding agent to a target. Such data can be used to
compare different proteins, targets, and conditions. This information can also be
used to develop structure-activity relationships (SAR). For example, the kinetic and
equilibrium binding parameters of variant proteins can be compared to the parameters
of a reference or parent protein. Variant amino acids at given positions can be identified
that correlate with particular binding parameters, e.g., high affinity and slow K
off. This information can be combined with structural modeling (e.g., using homology
modeling, energy minimization, or structure determination by x-ray crystallography
or NMR).
[0113] Proteins used for evaluating affinities can be produced in recombinant form and can
include tags suitable for purification or immobilization, e.g., a FLAG tag, myc tag,
hemagglutinin tag, His tag, or Fc domain fusion. Extracellular domains of receptor
proteins (such as IL-1RI, and IL-1RAcP) can be produced in recombinant form by expression,
e.g., in bacterial or insect cells, for example, using baculovirus expression in Sf9
cells. Soluble receptor proteins can be immobilized in the BIAcore system, e.g., using
chips that include reagents that bind to their tags, for example, a chip coated with
IgG specific for the Fc domain or other tag.
Cellular Activity Assays
[0114] The ability of receptor binding agents to function as receptor antagonists can be
evaluated, e.g., in a cell based assay. For example, it is possible to evaluate IL-1RI
inhibition by a receptor binding agent. Several exemplary assays for IL-1 activity
are described in Boraschi et al. and include T cell proliferation assays, IL-6 and
IL-8 production assays, and inhibition of calcium influx.
[0115] In one exemplary assay, the ability of a receptor binding agent is evaluated for
its ability to inhibit IL-1β stimulated release of IL-6 from human fibroblasts. Inhibition
of IL-1β-stimulated cytokine release in MRC5 cells is correlated with the agent's
ability to inhibit IL-1 mediated activity
in vivo. Details of the assay are described in
Dinarello et al., Current Protocols in Immunology, Ch. 6.2.1-6.2.7, John Wiley and
Sons Inc., 2000. Briefly, human MRC5 human fibroblasts (ATCC # CCL-171 , Manassas VA, USA) are grown
to confluency in multi-well plates. Cells are treated with titrated doses of the receptor
binding agent and controls. Cells are subsequently contacted with 100 pg/ml of IL-1β
in the presence of the titrated agent and/or controls. Negative control cells are
not stimulated with IL-1β. The amounts of IL-6 released in each group of treated cells
is measured using an IL-6 ELISA kit (e.g., BD Pharmingen, Franklin Lakes, NJ, USA).
Controls that can be used include buffer alone, IL-1Ra, and antibodies to IL-1β.
[0116] Efficacy of a receptor binding agent can also be evaluated
in vivo. An exemplary assay is described in
Economides et al., Nature Med., 9:47-52 (2003). Briefly, mice are injected intraperitoneally with titrated doses of the receptor
binding agent and controls. Twenty-four hours after injection, mice are injected subcutaneously
with recombinant human IL-1β at a dose of 1 µg/kg. Two hours after injection of the
IL-1β (peak IL-6 response time), mice are sacrificed, and blood is collected and processed
for serum. Serum IL-6 levels are assayed by ELISA. Percent inhibition can be calculated
based on the ratio of IL-6 detected in experimental animal serum to IL-6 detected
in controls.
[0117] Other exemplary assays for IL-1 activity in vivo are described in Boraschi et al.
and include an anorexia, hypoglycemia, and neutrophilia assay.
Production
[0118] Receptor binding agents can be produced by expression in recombinant host cells,
but also by other methods such as in vitro transcription and translation and chemical
synthesis.
[0119] For cellular expression, one or more nucleic acids (e.g., cDNA or genomic DNA) encoding
a receptor binding agent may be inserted into a replicable vector for cloning or for
expression. Various vectors are publicly available. The vector may, for example, be
a plasmid, cosmid, viral genome, phagemid, phage genome, or other autonomously replicating
sequence. The appropriate coding nucleic acid sequence may be inserted into the vector
by a variety of procedures. For example, appropriate restriction endonuclease sites
can be engineered (e.g., using PCR). Then restriction digestion and ligation can be
used to insert the coding nucleic acid sequence at an appropriate location. Vector
components generally include one or more of an origin of replication, one or more
marker genes, an enhancer element, a promoter, and a transcription termination sequence.
[0120] The receptor binding agent may be produced recombinantly either in isolation but
also by fusion to one or more other components, such as a signal sequence, an epitope
or purification moiety, and a label. The receptor binding agent can include the pro
domain of an interleukin-1 family member, e.g., which subsequently can be removed
by proteolytic processing.
[0121] For bacterial expression, the receptor binding agent can be produced with or without
a signal sequence. For example, it can be produced within cells so that it accumulates
in inclusion bodies, or in the soluble fraction. It can also be secreted, e.g., by
addition of a prokaryotic signal sequence, e.g., an appropriate leader sequence such
as from alkaline phosphatase, penicillinase, or heat-stable enterotoxin II. Exemplary
bacterial host cells for expression include any transformable
E. coli K-12 strain (such as
E. coli BL21, C600, ATCC 23724;
E. coli HB101 NRRLB-11371, ATCC-33694;
E. coli MM294 ATCC-33625;
E. coli W3110 ATCC-27325), strains of
B.
subtilis, Pseudomonas, and other bacilli. Proteins produced in bacterial systems will typically lack glycosylation.
Accordingly, in some embodiments, the receptor binding agents defined in the claims
are substantially free of glycosylation, e.g., free of glycosylation modifications
of a mammalian or other eukaryotic cell.
[0122] The receptor binding agent can be expressed in a yeast host cell, e.g.,
Saccharomyces cerevisiae, Schizosaccharomyces pombe, Hanseula, or
Pichia pastoris. For yeast expression, the receptor binding agent can also be produced intracellularly
or by secretion, e.g., using the yeast invertase leader or alpha factor leader (including
Saccharomyces and
Kluyveromyces forms), or the acid phosphatase leader, or the
C.
albicans glucoamylase leader (
EP 362,179 published 4 Apr. 1990). In mammalian cell expression, mammalian signal sequences may be used to direct
secretion of the protein, such as signal sequences from secreted polypeptides of the
same or related species, as well as viral secretory leaders. Alternatively, the receptor
binding agent can be produced with a pro domain of an interleukin-1 family member,
e.g., an IL-1α or IL-1β pro domain.
[0123] Both expression and cloning vectors contain a nucleic acid sequence that enables
the vector to replicate in one or more selected host cells. Such sequences are well
known for a variety of bacteria, yeast, and viruses. The origin of replication from
the plasmid pBR322 is suitable for most Gram-negative bacteria; the 2µ plasmid origin
is suitable for yeast; and various viral origins (SV40, polyoma, adenovirus, VSV or
BPV) are useful for cloning vectors in mammalian cells.
[0124] Expression and cloning vectors typically contain a selection gene or marker. Typical
selection genes encode proteins that (a) confer resistance to antibiotics or other
toxins, e.g., ampicillin, neomycin, methotrexate, or tetracycline, (b) complement
auxotrophic deficiencies (such as the URA3 marker in
Saccharomyces), or (c) supply critical nutrients not available from complex media, e.g., the gene
encoding D-alanine racemase for
Bacilli. Various markers are also available for mammalian cells, e.g., DHFR or thymidine kinase.
DHFR can be used in conjunction with a cell line (such as a CHO cell line) deficient
in DHFR activity, prepared and propagated as described by
Urlaub et al., Proc. Natl. Acad. Sci. USA, 77:4216 (1980).
[0125] Expression and cloning vectors usually contain a promoter operably linked to the
nucleic acid sequence encoding the receptor binding agent to direct mRNA synthesis.
Exemplary promoters suitable for use with prokaryotic hosts include the β-lactamase
and lactose promoter systems (
Chang et al., Nature, 275:615 (1978);
Goeddel et al., Nature, 281:544 (1979)), alkaline phosphatase, a tryptophan (trp) promoter system (
Goeddel, Nucleic Acids Res., 8:4057 (1980);
EP 36,776), and hybrid promoters such as the tac promoter (
deBoer et al., Proc. Natl. Acad. Sci. USA, 80:21-25 (1983)). Promoters for use in bacterial systems can also contain an appropriately located
Shine-Dalgarno sequence. The T7 polymerase system can also be used to drive expression
of a nucleic acid coding sequence placed under control of the T7 promoter. See, e.g.,
the pET vectors (EMD Chemicals, Gibbstown NJ, USA) and host cells, e.g., as described
in Novagen User Protocol TB053 available from EMD Chemicals and
US 5,693,489. For example, such vectors can be used in combination with BL21(DE3) cells and BL21(DE3)
pLysS cells to produce protein, e.g., at least 0.05, 0.1, or 0.3 mg per ml of cell
culture. Other cells lines that can be used include DE3 lysogens of B834, BLR, HMS174,
NovaBlue, including cells bearing a pLysS plasmid.
[0126] Exemplary promoters for use with yeast cells include the promoters for 3-phospho-glycerate
kinase (
Hitzeman et al., J. Biol. Chem., 255:2073 (1980)) or other glycolytic enzymes (
Hess et al., J. Adv. Enzyme Reg., 7:149 (1968);
Holland, Biochemistry, 17:4900 (1978)), such as enolase, glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvate
decarboxylase, phosphofructokinase, glucose-6-phosphate isomerase, and pyruvate kinase.
Other exemplary yeast promoters are inducible and have the additional advantage of
transcription controlled by growth conditions. Examples of inducible promoters include
the promoter regions for alcohol dehydrogenase 2, isocytochrome C, acid phosphatase,
metallothionein, and enzymes responsible for maltose and galactose utilization.
[0127] Expression of mRNA encoding a receptor binding agent from vectors in mammalian host
cells can be controlled, for example, by promoters obtained from the genomes of viruses
such as polyoma virus, adenovirus (such as Adenovirus 2), bovine papilloma virus,
avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus and Simian Virus
40 (SV40), from heterologous mammalian promoters, e.g., the actin promoter or an immunoglobulin
promoter, and from heat-shock promoters. Heterologous promoter systems can also be
used, e.g., promoters responsive to tetracycline. See
Urlinger, S., et al. (2000) Proc. Natl. Acad. Sci. USA 97(14):7963-7968. Transcription can also be driven by an enhancer sequence, located in cis or trans.
Exemplary mammalian enhancer sequences include those for globin, elastase, albumin,
α-fetoprotein, and insulin. Additional examples include the SV40 enhancer on the late
side of the replication origin (bp 100-270), the cytomegalovirus early promoter enhancer,
the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers.
The enhancer may be spliced into the vector at a position 5' or 3' to the coding sequence
for the receptor binding agent, but is preferably located at a site 5' from the promoter.
[0128] Expression vectors used in eukaryotic host cells (yeast, fungi, insect, plant, animal,
human, or nucleated cells from other multicellular organisms) can also contain sequences
necessary for the termination of transcription and for stabilizing the mRNA. Such
sequences are commonly available from the 5' and, occasionally 3', untranslated regions
of eukaryotic or viral DNAs or cDNAs. These regions contain nucleotide segments transcribed
as polyadenylated fragments in the untranslated portion of the mRNA encoding the receptor
binding agent. The expression vector may also include one or more intronic sequences.
[0129] The receptor binding agent can also be expressed in insect cells, e.g., Sf9 or SF21
cells, e.g., using the pFAST-BAC
™ system. Additional exemplary baculovirus expression vectors are available from Invitrogen,
Life Technologies, Carlsbad CA, USA. The receptor binding agent can also be expressed
in mammalian cells. For example, cell lines of mammalian origin also may be employed.
Examples of mammalian host cell lines include the COS-7 line of monkey kidney cells
(ATCC CRL 1651) (
Gluzman et al., Cell 23:175, 1981), L cells, C127 cells, 3T3 cells (ATCC CCL 163), Chinese hamster ovary (CHO) cells,
HeLa cells, and BHK (ATCC CRL 10) cell lines, and the CV1/EBNA cell line derived from
the African green monkey kidney cell line CV1 (ATCC CCL 70) as described by
McMahan et al. (EMBO J. 10: 2821, 1991). Established methods for introducing DNA into mammalian cells have been described
(
Kaufman, R. J., Large Scale Mammalian Cell Culture, 1990, pp. 1569).
[0131] Once expressed in cells, receptor binding agents can be recovered from culture medium,
inclusion bodies, or cell lysates. Cells can be disrupted by various physical or chemical
means, such as freeze-thaw cycling, sonication, mechanical disruption, or cell lysing
agents (e.g., detergents).
[0132] Receptor binding agents can be purified from other cell proteins or polypeptides
that can be found in cell lysates or in the cell medium. Various methods of protein
purification may be employed and such methods are known in the art and described for
example in
Deutscher, Methods in Enzymology, 182 (1990); and
Scopes,Protein Purification: Principles and Practice, Springer-Verlag, New York (2010)
(ISBN: 1441928332). Examples of purification procedures include: by fractionation on an ion-exchange
column; ethanol precipitation; reverse phase HPLC; chromatography on silica or on
a cation-exchange resin such as DEAE; chromatofocusing; SDS-PAGE; ammonium sulfate
precipitation; gel filtration using, for example, Sephadex G-75; protein A Sepharose
columns to remove contaminants such as IgG; and affinity columns (e.g., metal chelating
columns to bind epitope-tagged forms of the protein and columns with various ligands
to bind any purification moiety that is associated with the receptor binding agent).
A purification method can include a combination of two different ion-exchange chromatography
steps, e.g., cation exchange chromatograph followed by anion exchange chromatography,
or vice versa. Receptor binding agents can be eluted from ion exchange resin by a
variety of methods including salt and/or pH gradients or steps. In some embodiments,
the receptor binding agent defined in the claims includes a purification moiety (such
as epitope tags and affinity handles). Such moieties can be used for affinity chromatography
and can be optionally removed by proteolytic cleavage.
[0133] Ion exchange chromatography may also be used as an ion exchange separation technique.
Ion exchange chromatography separates molecules based on differences between the overall
charge of the molecules and can be used to separate intact form of receptor binding
agents from other forms of such proteins.
[0134] Anionic or cationic substituents may be attached to matrices in order to form anionic
or cationic supports for chromatography. Anionic exchange substituents include diethylaminoethyl
(DEAE), quaternary aminoethyl (QAE) and quaternary amine (Q) groups. Cationic substitutents
include carboxymethyl (CM), sulfoethyl (SE), sulfopropyl (SP), phosphate (P) and sulfonate
(S). Cellulose ion exchange resins such as DE23, DE32, DE52, CM-23, CM-32 and CM-52
are available from Whatman Ltd. (Maidstone, Kent, U.K). SEPHADEX
™ and other cross-linked ion exchangers are also known. For example, DEAE-, QAE-, CM-,
and SP-SEPHADEX
™ and DEAE-, Q-, CM- and S-SEPHAROSE
™ and SEPHAROSE
™ Fast Flow are available from Pharmacia AB. DEAE and CM derivatized ethylene glycol-methacrylate
copolymer such as TOYOPEARL DEAE-650S or M and TOYOPEARL CM-650S or M are available
from Toso Haas Co. (Philadelphia, PA, USA).
[0135] A cation exchange surface is an ion exchange surface with covalently bound negatively
charged ligands, and which thus has free cations for exchange with cations in a solution
in contact with the surface. Exemplary surfaces include cation exchange resins, such
as those wherein the covalently bound groups are carboxylate or sulfonate. Commercially
available cation exchange resins include CMC-cellulose, SP-Sephadex
™ and Fast S-Sepharose
™ (Pharmacia).
[0136] An anion exchange surface is an ion exchange surface with covalently bound positively
charged groups, such as quaternary amino groups. An exemplary anion exchange surface
is an anion exchange resin, such as DEAE cellulose, TMAE, QAE Sephadex
™ and Fast Q Sepharose
™ (Pharmacia).
[0137] An exemplary purification scheme for a receptor binding agent includes lysing
E. coli cells in lysis buffer following by depth filtration. The material is then subject
to cation exchange chromatography (CEX). The CEX eluate is then flowed over anion
exchange media in an anion exchange chromatography (AEX) step. The AEX FT can be subject
to a polishing step. Material can then be processed by ultrafiltration/diafiltration,
e.g., to concentrate or desalt the material. Ultrafiltration/diafiltration membranes
may be selected based on nominal molecular weight cut-off ("NMWCO") so as to retain
the protein in the retentate, while allowing low molecular weight materials such as
salts to pass into the filtrate. Any buffering solution or sterile water may be used
during the final buffer exchange step, e.g., depending on the desired final pH and
conductivity of the product.
[0138] A receptor binding agent can be stored in a variety of solutions, including water,
PBS, and buffered solutions. Exemplary buffered solutions include sodium acetate pH
4.5, sodium acetate pH 4.7, sodium acetate pH 4.9, sodium acetate pH 5.1, sodium acetate
pH 5.3, sodium acetate pH 5.5, succinate pH 5.2, succinate pH 5.4, succinate pH 5.6,
succinate pH 5.8, histidine pH 5.7, histidine pH 6.0, histidine pH 6.3, histidine
6.6, sodium phosphate pH 6.5, sodium phosphate pH 6.7, sodium phosphate 7.0, sodium
phosphate pH 7.3, sodium phosphate pH 7.7, imidazole pH 6.5, imidazole pH 6.8, imidazole
pH 7.2, Tris pH 7.0, Tris pH 7.5, Tris pH 7.7. Buffering agents can be present, e.g.,
at a concentration of about 1-100mM, 5-50mM, 10-50mM, or 5-25 mM. The solution can
further include a salt such as NaCl (e.g., 50 mM, 150 mM, or 250 mM, and ranges therebetween),
arginine (e.g., at about 1%, 2%, 3%, 4%, 5%, 7.5%, and ranges therebetween), sucrose
(e.g., at about 1%, 2%, 3%, 4%, 5%, 7.5%, 8.5%, 10%, 15%, and ranges therebetween),
and/or glycerol (e.g., at about 0.5%, 1%, 2%, 3%, 4%, 5%, 7.5%, 8.5%, 10%, 15%, and
ranges therebetween).
[0139] The receptor binding agent can be present in the composition in an amount of at least
50 mg, 100 mg, 500 mg, 1 g, 5 g, 10g, or more.
Analytical Methods
[0140] Host cell proteins (HCP) refer to proteins in a preparation that differ from a receptor
binding agent, and for example are endogenous proteins of the host cell from which
the receptor binding agent was prepared, typically E.
coli proteins. Preferably, host cell proteins are present at fewer than 10000, 1000, 900,
800, or 700 ppm (parts per million). HCP can be detected, for example, by ELISA or
other detection methods. For example, the ELISA can use polyclonal antibodies to HCPs.
An exemplary kit is available from Cygnus Technologies (CN# F410; South port NC USA).
Another exemplary kit uses AlphaScreen technology (AlphaLisa
® E. coli HCP Kit, Product Number AL261 C/F, Perkin Elmer, Waltham MA USA).
[0141] Material containing or potentially containing a receptor binding agent can be evaluated,
e.g., using high pressure liquid chromatography. Exemplary analytical techniques include
weak cation exchange high performance liquid chromatography (wCEX-HPLC), size exclusion
high performance liquid chromatography (SE-HPLC), reverse phase liquid chromatography,
ESI-MS, turbospray ionization mass spectrometry, nanospray ionization mass spectrometry,
thermospray ionization mass spectrometry, sonic spray ionization mass spectrometry,
SELDI-MS and MALDI-MS.
[0142] In several embodiments, the N-terminal region of a receptor binding agent includes
sequences identical to peptides from the N-terminal region of IL-1β, for example,
the peptide APVRS (SEQ ID NO:58). Recombinant cells (particularly
E. coli cells) expressing such proteins can produce intact protein as well as other isoforms,
including the des-Ala isoform and an isoform with an additional methionine (e.g.,
N-terminal to Ala1). Receptor binding agents that include a proline at amino acid
position 2 (where the N terminal residue is at position 1) can be susceptible to cleavage
by
E. coli proteases, such as aminopeptidase P which has cleavage specificity for X-PRO. This
cleavage can remove the N-terminal amino acid. For example, P03, P04, and P05 have
a proline at position 2. The intact forms of P03, P04, and P05 are 153 amino acids
in length and begin with alanine whereas the des-Ala species are 152 amino acids in
length and begin with proline.
[0143] Analytical techniques such as those above can be used to distinguish between intact
forms and other forms, e.g., a des-Ala species. An analytical exemplary technique
is wCEX-HPLC. For example, P05 can be evaluated using a Dionex ProPac
® WCX-10 4x250 mm column (Product Number 054993) as described in Example 9 below. WCX-HPLC
peaks can be evaluated by C4 reversed-phase (RP)-HPLC on-line with mass spectrometry.
Intact P05 has theoretical mass: 17700.4 Da and is detectable as 17700.4 Da. The des-Ala
species is detectable as 17629.4 Da, which is 71 Da less than the mass of the intact
P05. The 71 Da reduction in mass corresponds to removal of a single alanine residue.
Pharmaceutical Compositions
[0144] A receptor binding agent can be formulated as a pharmaceutical composition. The invention
provides a pharmaceutical composition as defined in the accompanying claims. Typically,
the composition is sterile and includes one or more of a buffer, a pharmaceutically
acceptable salt, and an excipient or stabilizer. For example, the composition can
be an aqueous composition. A receptor binding agent can be formulated according to
standard methods for a biologic. See e.g.,
Gennaro (ed.), Remington: The Science and Practice of Pharmacy, 20th ed., Lippincott,
Williams & Wilkins (2000) (ISBN: 0683306472);
Ansel et al., Pharmaceutical Dosage Forms and Drug Delivery Systems, 7th Ed.., Lippincott
Williams & Wilkins Publishers (1999) (ISBN: 0683305727);
Kibbe (ed.), Handbook of Pharmaceutical Excipients, 3rd ed. (2000) (ISBN: 091733096X);
Protein formulation and delivery, McNally and Hastedt (eds.), Informa Health Care
(ISBN: 0849379490) (2007).
[0145] A receptor binding agent for a pharmaceutical composition is typically at least 10,
20, 50, 70, 80, 90, 95, 98, 99, or 99.99% pure and typically free of human proteins.
It can be the only protein in the composition or the only active protein in the composition.
It can also be combined with one or more other active proteins, e.g., one or more
other purified active proteins, e.g., a related or unrelated protein. In some embodiments,
the composition can contain the receptor binding agent at a concentration of between
about 0.001 - 10%, e.g., 0.001 - 0.1%, 0.01 - 1%, or 0.1% - 10%.
[0146] Accordingly, also featured herein are purified and isolated forms of the agents defined
in the appended claims. The term "isolated" refers to material that is removed from
its original environment (
e.g., the cells or materials from which the receptor binding agent is produced). Pharmaceutical
compositions can be substantially free of pyrogenic materials, substantially free
of nucleic acids, and/or substantially free of cellular enzymes and components, such
as polymerases, ribosomal proteins, and chaperone proteins.
[0147] A pharmaceutical composition can include a pharmaceutically acceptable carrier. As
used herein, "pharmaceutically acceptable carrier" includes any and all solvents,
dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption
delaying agents, and the like that are physiologically compatible. A "pharmaceutically
acceptable salt" refers to a salt that retains the desired biological activity of
the parent compound and does not impart any undesired toxicological effects (see e.g.,
Berge, S.M., et al. (1977) J. Pharm. Sci. 66:1-19), e.g., acid addition salts and base addition salts.
[0148] In one embodiment, the receptor binding agent is formulated with one or more excipients,
such as sodium chloride, and a phosphate buffer (e.g., sodium dibasic phosphate heptahydrate,
sodium monobasic phosphate), and polysorbate. It can be provided, for example, in
a buffered solution, e.g., at a concentration of about 5-100, 5-30, 30-50, or 50-100
mg/ml and can be stored at 2-8°C. Pharmaceutical compositions may also be in a variety
of other forms. These include, for example, liquid, semi-solid and solid dosage forms,
such as liquid solutions (e.g., injectable and infusible solutions), dispersions or
suspensions, and liposomes. The preferred form can depend on the intended mode of
administration and therapeutic application. Compositions for the agents described
herein are typically in the form of injectable or infusible solutions, or are for
topical or ocular delivery (see below).
[0149] Pharmaceutical compositions typically are sterile and stable under the conditions
of manufacture and storage. A pharmaceutical composition can also be tested to ensure
it meets regulatory and industry standards for administration. The composition can
be formulated as a solution, microemulsion, dispersion, liposome, or other ordered
structure suitable to high drug concentration. Sterile injectable solutions can be
prepared by incorporating an agent described herein in the required amount in an appropriate
solvent with one or a combination of ingredients enumerated above, as required, followed
by filtered sterilization. Generally, dispersions are prepared by incorporating an
agent described herein into a sterile vehicle that contains a basic dispersion medium
and the required other ingredients from those enumerated above. In the case of sterile
powders for the preparation of sterile injectable solutions, the preferred methods
of preparation are vacuum drying and freeze-drying that yields a powder of an agent
described herein plus any additional desired ingredient from a previously sterile-filtered
solution thereof. The proper fluidity of a solution can be maintained, for example,
by the use of a coating such as lecithin, by the maintenance of the required particle
size in the case of dispersion and by the use of surfactants. Prolonged absorption
of injectable compositions can be engineered by inclusion of an agent that delays
absorption, for example, monostearate salts and gelatin.
[0150] For example, a receptor binding agent can be associated with a polymer, e.g., a substantially
non-antigenic polymer, such as a polyalkylene oxide or a polyethylene oxide. In some
embodiments, the polymer covalently attached to the receptor binding agent, e.g.,
directly or indirectly. Suitable polymers will vary substantially by weight. Polymers
having molecular number average weights ranging from about 200 to about 35,000 Daltons
(or about 1,000 to about 15,000, and 2,000 to about 12,500) can be used. For example,
a receptor binding agent can be conjugated to a water soluble polymer, e.g., a hydrophilic
polyvinyl polymer, e.g. polyvinylalcohol or polyvinylpyrrolidone. A non-limiting list
of such polymers include polyalkylene oxide homopolymers such as polyethylene glycol
(PEG) or polypropylene glycols, polyoxyethylenated polyols, copolymers thereof and
block copolymers thereof, provided that the water solubility of the block copolymers
is maintained. Additional useful polymers include polyoxyalkylenes such as polyoxyethylene,
polyoxypropylene, and block copolymers of polyoxyethylene and polyoxypropylene (Pluronics);
polymethacrylates; carbomers; branched or unbranched polysaccharides that includee
the saccharide monomers D-mannose, D- and L-galactose, fucose, fructose, D-xylose,
L-arabinose, D-glucuronic acid, sialic acid, D-galacturonic acid, D-mannuronic acid
(e.g. polymannuronic acid, or alginic acid), D-glucosamine, D-galactosamine, D- glucose
and neuraminic acid including homopolysaccharides and heteropolysaccharides such as
lactose, amylopectin, starch, hydroxyethyl starch, amylose, dextrane sulfate, dextran,
dextrins, glycogen, or the polysaccharide subunit of acid mucopolysaccharides, e.g.
hyaluronic acid; polymers of sugar alcohols such as polysorbitol and polymannitol;
heparin or heparan.
[0151] In certain embodiments, the receptor binding agent may be prepared with a carrier
that will protect the compound against rapid release. It may be delivered as a controlled
release formulation, delivered by an implant or a microencapsulated delivery system.
Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate,
polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid.
See generally e.g.,
Sustained and Controlled Release Drug Delivery Systems, J.R. Robinson, ed., Marcel
Dekker, Inc., New York, 1978.
Administration
[0152] A receptor binding agent can be administered to a subject, e.g., a human subject,
by a variety of methods, such as intravenous administration as a bolus or by continuous
infusion over a period of time, by intramuscular, intramuscular, intraarterial, intrathecal,
intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, intrasynovial,
transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid,
intraspinal, epidural injection, intrasternal injection and infusion. Still other
modes of administration include topical (e.g., dermal or mucosal) or inhalation (e.g.,
intranasal or intrapulmonary) routes. For many applications, the route of administration
is one of: intravenous injection or infusion, subcutaneous injection, or intramuscular
injection.
[0153] A receptor binding agent can be administered as a fixed dose or in a mg/kg dose.
It can be administered intravenously (IV) or subcutaneously (SC). The receptor binding
agent can administered, for example, every day, every other day, every third, fourth
or fifth day, every week, every three to five weeks, e.g., every fourth week, or monthly.
[0154] A pharmaceutical composition may include a "therapeutically effective amount" of
the isolated protein defined in the accompanying claims. A therapeutically effective
amount may vary according to factors such as the disease state, age, sex, and weight
of the individual, and the ability of the compound to elicit a desired response in
the individual, e.g., amelioration of at least one disorder parameter, or amelioration
of at least one symptom of the disorder (and optionally the effect of any additional
agents being administered). A therapeutically effective amount is also one in which
any toxic or detrimental effects of the composition are outweighed by the therapeutically
beneficial effects. A receptor binding agent is typically administered in a therapeutically
effective amount.
[0155] Pharmaceutical compositions can be administered using medical devices, e.g., implants,
infusion pumps, hypodermic needles, and needleless hypodermic injection devices. The
device can include, e.g., one or more housings for storing pharmaceutical compositions,
and can be configured to deliver unit doses of the receptor binding agent, and optionally
a second agent. The doses can be fixed doses, i.e., physically discrete units suited
as unitary dosages for the subjects to be treated; each unit can contain a predetermined
quantity of receptor binding agent calculated to produce the desired therapeutic effect
in association with a pharmaceutical carrier and optionally in association with another
agent.
[0156] In some embodiments, to treat a disorder as defined in the accompanying claims, a
receptor binding agent can be administered to the subject having the disorder in an
amount and for a time sufficient to induce a sustained improvement in at least one
indicator that reflects the severity of the disorder. An improvement is considered
"sustained" if the subject exhibits the improvement on at least two occasions separated
by one to four weeks. The degree of improvement can be determined based on signs or
symptoms, and can also employ questionnaires that are administered to the subject,
such as quality-of-life questionnaires.
[0157] Various indicators that reflect the extent of the illness may be assessed for determining
whether the amount and time of the treatment is sufficient. The baseline value for
the chosen indicator or indicators is established by examination of the subject prior
to administration of the first dose of the receptor binding agent. Preferably, the
baseline examination is done within about 60 days of administering the first dose.
[0158] Improvement can be induced by repeatedly administering a dose of the receptor binding
agent until the subject manifests an improvement over baseline for the chosen indicator
or indicators. In treating chronic conditions, the degree of improvement may be obtained
by repeated administration over a period of at least a month or more, e.g., for one,
two, or three months or longer, or indefinitely. In treating an acute condition, the
agent can be administered for a period of one to six weeks or even a single dose.
[0159] Although the extent of illness after treatment may appear improved according to one
or more indicators, treatment may be continued indefinitely at the same level or at
a reduced dose or frequency. Treatment may also be discontinued, e.g., upon improvement
or disappearance of symptoms. Once treatment has been reduced or discontinued, it
may be resumed if symptoms should reappear.
Treatments
[0160] IL-1 mediated disorders include acute and chronic disorders, including autoimmune
disorders and inflammatory disorders. IL-1 mediated disorders include systemic and
non-systemic disorders. It is well established that IL-1α and IL-1β are potent pro-inflammatory
cytokines implicated in infectious responses as well as in inflammatory disease, including
rheumatoid arthritis. Increased IL-1 production has been observed in patients with
several autoimmune disorders, ischemia, and various cancers, therefore implicating
IL-1 in these and related diseases.
[0162] The term "treat" refers to the administration of an agent to a subject,
e.g., a patient, in an amount, manner, and/or mode effective to improve a condition, symptom,
or parameter associated with a disorder,
e.g., a disorder described herein, or to prevent progression of a disorder, to either a
statistically significant degree or to a degree detectable to one skilled in the art.
The treatment can be to intended to cure, heal, alleviate, relieve, alter, remedy,
ameliorate, palliate, improve or affect the disorder, the symptoms of the disorder
or the predisposition toward the disorder. An effective amount, manner, or mode can
vary depending on the subject and may be tailored to the subject. Exemplary subjects
include humans, primates, and other non-human mammals. An agent can also be given
prophylactically to reduce the risk of the occurrence of a disorder or symptom thereof.
[0163] The invention provides a pharmaceutical composition for use as a medicament, and
for use in treating cancer, as defined by the appended claims
[0164] An IL-1 mediated disorder can be an autoimmune disorder, but these are not claimed.
Examples of IL-1 mediated autoimmune disorders include: rheumatoid arthritis, ankylosing
spondylitis, Behcet's syndrome, inflammatory bowel diseases (including Crohn's disease
and ulcerative colitis), asthma, psoriasis, Type I diabetes, and other disorders identified
herein. An IL-1 mediated disorder can be an inflammatory disorder, but these are not
claimed..
[0165] Exemplary IL-1 mediated disorders include:
Rheumatoid Arthritis and related arthritides. A receptor binding agent can be used to treat a subject having or at risk for rheumatoid
arthritis, but that is not claimed. Rheumatoid arthritis (RA) is a chronic systemic
autoimmune inflammatory disease that affects the synovial membrane in joints and which
damages articular cartilage. The pathogenesis of RA is T lymphocyte dependent and
can include the production of autoantibodies known as rheumatoid factors. Complexes
of rheumatoid factor and antigen can form and accumulate in joint fluid and blood,
inducing the infiltration of lymphocytes, neutrophils, and monocytes into the synovium.
Joints are typically affected in a symmetrical pattern, but extra-articular disease
may also occur, e.g., causing pulmonary fibrosis, vasculitis, and cutaneous ulcers,
or Felty's syndrome which manifests as neutropenia, thrombocytopenia and splenomegaly.
Patients can also exhibit rheumatoid nodules in the area of affected joints, pericarditis,
pleuritis, coronary arteritis, and interstitial pneumonitis with pulmonary fibrosis.
A form of IL-1Ra is indicated for moderately to severely active RA. See, e.g.,
Cohen, S. et al. Arthritis & Rheumatism 46, 614-24 (2002);
Fleischmann, R.M. et al. Arthritis & Rheumatism 48, 927-34 (2003);
Nuki, G., et al. Arthritis & Rheumatism 46, 2838-46 (2002);
Schiff, M.H. et al. Arthritis & Rheumatism 50, 1752-60 (2004).
[0166] Symptoms of active RA include fatigue, lack of appetite, low grade fever, muscle
and joint aches, and stiffness. Muscle and joint stiffness are usually most notable
in the morning and after periods of inactivity. During flares, joints frequently become
red, swollen, painful, and tender, generally as a consequence of synovitis. Scales
useful for assessing RA and symptoms of RA include the Rheumatoid Arthritis Severity
Scale (RASS;
Bardwell et al., (2002) Rheumatology 41(1):38-45), SF-36 Arthritis Specific Health Index (ASHI;
Ware et al., (1999) Med. Care. 37(5 Suppl):MS40-50), Arthritis Impact Measurement Scales or Arthritis Impact Measurement Scales 2 (AIMS
or AIMS2;
Meenan et al. (1992) Arthritis Rheum. 35(1):1-10); the Stanford Health Assessment Questionnaire (HAQ), HAQII, or modified HAQ (see,
e.g.,
Pincus et al. (1983) Arthritis Rheum. 26(11):1346-53).
[0167] A receptor binding agent described herein can be administered to a subject having
or at risk for RA to delay onset and/or ameliorate one or more of the foregoing signs
and symptoms, but that is not claimed. The subject can have moderate to severe active
RA. The subject can be a non-responder to TNF inhibitor therapy (e.g., therapy with
ENBREL
® (etanercept), HUMIRA
® (adalimumab), or REMICADE
® (infliximab)); the subject can have previously been administered a TNF inhibitor;
or the subject can also be continuing to receive a TNF inhibitor (and responding or
not responding).
[0168] The subject can also be administered methotrexate. The subject can be administered
one or more other DMARDS (disease modifying anti-rheumatic drugs), a corticosteroid,
and/or a non-steroidal anti-inflammatory. Still other drugs which can be co-administered
with a receptor binding agent include inhibitors of CD28 (e.g., CTLA4-lg), inhibitors
of RANKL, IFNγ, IL-6, IL-8, and IL-17. Inhibitors include antibodies to such mediators,
soluble receptors specific for such mediators, and/or antibodies to receptors for
such mediators.
[0169] Juvenile Chronic Arthritis. A receptor binding agent can be used to treat juvenile chronic arthritis, e.g., in
a subject that is less than 21, 18, 17, 16, 15, or 14 years of age, but that is not
claimed. Juvenile chronic arthritis resembles RA in several respects. Subjects can
be rheumatoid factor positive. Subjects may have pauciarticular, polyarticular, or
systemic forms of the disease. The arthritis can cause joint ankylosis and retarded
growth and can also lead to chronic anterior uveitis and systemic amyloidosis. A receptor
binding agent can be used delay onset of or ameliorate one or more such symptoms,
but that is not claimed.
[0170] A receptor binding agent can be used to treat juvenile idiopathic arthritis, including
systemic onset juvenile idiopathic arthritis (SO-JIA) , but that is not claimed. Subjects
may have failed prior corticosteroid treatment or required corticosteroid treatment
at a daily dose equal to or over 0.3 mg/kg. See e.g.,
Quartier et al. (2011) Ann Rheum Dis. 70(5):747-54.
[0171] Other Rheumatic Disorders. A receptor binding agent described herein can also be used to treat other rheumatic
disorders including scleroderma, systemic lupus erythematosus, gout, osteoarthritis,
polymyalgia rheumatica, psoriatic arthritis and chronic Lyme arthritis, inflammation
of the voluntary muscle and other muscles, including dermatomyositis, inclusion body
myositis, polymyositis, and lymphangioleimyomatosis, pyrogenic arthritis syndrome,
pediatric granulomatous arthritis (PGA)/Blau syndrome, and other rheumatic disorders
discussed herein, but that is not claimed.
[0172] A receptor binding agent can be used to treat metabolic rheumatic disorders, e.g.,
disorders associated with hyperuricemia, e.g., gout including chronic acute gout,
and other crystal-mediated arthropathies, but that is not claimed. The agent can be
used to treat drug-induced flares associated with gout, including for example flares
induced by xanthine oxidase inhibitors, urate oxidase, or uricosuric agents, but that
is not claimed. In gout, crystals of uric acid can activate the inflammasome and trigger
the release of IL-1β.
[0173] Spondyloarthropathies. A receptor binding agent can be used to treat spondyloarthropathies, which include
disorders such as ankylosing spondylitis, Reiter's syndrome, arthritis associated
with inflammatory bowel disease, spondylitis associated with psoriasis, juvenile onset
spondyloarthropathy and undifferentiated spondyloarthropathy, but that is not claimed.
Spondyloarthropathies are frequently associated with the HLA-B27 gene. Subjects may
lack rheumatoid factor and may exhibit sacroileitis with or without spondylitis and
inflammatory asymmetric arthritis. Subjects may also have ocular inflammation (see
below).
[0174] Scleroderma. A receptor binding agent can be used to treat scleroderma or systemic sclerosis,
but that is not claimed. Scleroderma is characterized by induration of the skin which
may be localized or systemic. Vascular lesions and endothelial cell injury in the
microvasculature can also be present. Subjects may exhibit mononuclear cell infiltrates
in the cutaneous lesions and have anti-nuclear antibodies. Other organs that show
pathogenesis can include: the gastrointestinal tract which may have smooth muscle
atrophy and fibrosis resulting in abnormal peristalsis/motility; the kidney which
may have concentric subendothelial intimal proliferation affecting small arcuate and
interlobular arteries with resultant reduced renal cortical blood flow, and which
can cause proteinuria, azotemia and hypertension; skeletal muscle which may involve
atrophy, interstitial fibrosis, inflammation, lung, interstitial pneumonitis and interstitial
fibrosis; and heart which can exhibit, e.g., contraction band necrosis and scarring/fibrosis.
A receptor binding agent described herein can be administered to a subject having
or at risk for scleroderma to ameliorate one or more of the foregoing signs and symptoms,
but that is not claimed.
[0175] Sjögren's Syndrome. A receptor binding agent can be used to treat Sjögren's syndrome, but that is not
claimed. Sjögren's syndrome is characterized by immune-mediated inflammation and subsequent
functional destruction of the tear glands and salivary glands. The disease can be
associated with or accompanied by inflammatory connective tissue diseases. The disease
is associated with autoantibody production against Ro and La antigens, both of which
are small RNA-protein complexes. Lesions can result in keratoconjunctivitis sicca,
xerostomia, with other manifestations or associations including biliary cirrhosis,
peripheral or sensory neuropathy, and palpable purpura. Treatment of ocular disorders
associated with Sjögren's is also discussed below, but that is not claimed.
[0176] Thyroid Disorders. A receptor binding agent can be used to treat a thyroid disorder, but that is not
claimed. Exemplary thyroid disorders include Graves' disease, Hashimoto's thyroiditis,
juvenile lymphocytic thyroiditis, and atrophic thyroiditis, and are the result of
an autoimmune response against thyroid antigens with production of antibodies that
react with proteins present in and often specific for the thyroid gland. Experimental
models are available including spontaneous models: rats (BUF and BB rats) and chickens
(obese chicken strain) and inducible models created by immunization of animals with
either thyroglobulin, thyroid microsomal antigen (thyroid peroxidase).
[0177] Diabetic & Metabolic disorders. A receptor binding agent can be used to treat a diabetic disorder such as juvenile
onset diabetes (including autoimmune diabetes mellitus and insulin-dependent types
of diabetes) and maturity onset diabetes (including non-insulin dependent and obesity-mediated
diabetes), type I diabetes and type II diabetes, but that is not claimed. For example,
type I diabetes mellitus or insulin-dependent diabetes is associated with the autoimmune
destruction of pancreatic islet cells caused by auto-antibodies and auto-reactive
T cells. In addition, reducing IL-1β activity can improve glucose control and beta-cell
function and can be used to treat type II diabetes. See e.g.
Owyang et al. Endocrinology. 2010;151(6):2515-27. For example, a receptor binding agent described herein can be administered to a
subject that is not being administered insulin, e.g., the subject is not insulin dependent,
but that is not claimed. For example, the subject can be pre-diabetic. The subject
can have either impaired glucose tolerance or impaired fasting glucose. The subject
can be obese or have a body mass index that is above 23, 25, 30, 35, or 40 kg/m
2. The subject can be insulin resistant, and/or characterized by hyperglycemia or hyperinsulinemia.
The subject can be at risk for progression to type II diabetes. See also
Larsen, et al. (2007) NEJM 356:1517-26 and
Larsen, et al. (2009). Diabetes Care 32:1663-8. For example, the subject has a fasting plasma glucose of greater than 6.1, 6.5,
7, or 8 mmol/L. For example, the subject has an A1C level greater than 5.5, 5.7, 6,
6.4, 7, 7.5 or 8%.
[0178] For example, the subject is also administered an insulin secretagogue, e.g., such
as an sulfonylurea (e.g., chlorpropamide, tolazamide, acetohexamide, tolbutamide,
glyburide, glimepiride, glipizide) and/or meglitinides (e.g., repaglinide, nateglinide)
that stimulate insulin secretion. The subject can also be administered a biguanide
(e.g., metformin). The receptor binding agent can be administered to reduce loss of
and/or damage to pancreatic beta cells.
[0179] For example, the subject is heterozygous or homozygous for the C allele of rs4251961,
located near the 5' of the gene IL1RN.
[0180] Treatment with a receptor binding agent includes ameliorating or preventing deterioration
of secondary conditions associated with diabetes, such as diabetic retinopathy, kidney
transplant rejection in diabetic patients, obesity-mediated insulin resistance, and
renal failure, which itself may be associated with proteinuria and hypertension, but
that is not claimed.
[0181] Gastrointestinal Disorders. Receptor binding agents described herein can be used to treat an inflammatory gastrointestinal
disorder, including for example coeliac disease, Crohn's disease, ulcerative colitis,
idiopathic gastroparesis pancreatitis including chronic pancreatitis, acute pancreatitis,
inflammatory bowel disease and ulcers including gastric and duodenal ulcers, but that
is not claimed.
[0182] Pulmonary disorders. A receptor binding agent can be used to treat a pulmonary disease mediated by IL-1,
but that is not claimed. Exemplary pulmonary diseases include chronic obstructive
pulmonary disease (e.g. emphysema and chronic bronchitis), pulmonary alveolar proteinosis,
bleomycin-induced pneumopathy and fibrosis, pulmonary fibrosis, including idiopathic
pulmonary fibrosis and radiation-induced pulmonary fibrosis, pulmonary sarcoidosis,
cystic fibrosis, collagen accumulation in the lungs, ARDS, broncho-pulmonary dysplasia
(BPD), chronic obstructive pulmonary diseases, and chronic fibrotic lung disease of
preterm infants. In addition, the receptor binding agents described herein can be
used to treat occupational lung diseases, including asbestosis, coal worker's pneumoconiosis,
silicosis or similar conditions associated with long-term exposure to fine particles,
but that is not claimed. Inflammatory and fibrotic lung disease including eosinophilic
pneumonia, idiopathic pulmonary fibrosis, and hypersensitivity pneumonitis may involve
a misregulated immune-inflammatory response that can be treated using a receptor binding
agent.
[0183] Sarcoidosis is a condition of unknown etiology which is characterized by the presence
of epithelioid granulomas in nearly any tissue in the body; involvement of the lung
is most common. The pathogenesis involves the persistence of activated macrophages
and lymphoid cells at sites of the disease with subsequent chronic sequelae resultant
from the release of locally and systemically active products released by these cell
types.
[0184] Cardiovascular Disorders. A receptor binding agent described herein can be used to treat a cardiovascular disorder
or injury, such as aortic aneurysms, acute coronary syndrome, arteritis, vascular
occlusion, including cerebral artery occlusion, complications of coronary bypass surgery,
ischemia/reperfusion injury, heart disease, including atherosclerotic heart disease,
myocarditis, including chronic autoimmune myocarditis and viral myocarditis, heart
failure, including chronic heart failure, congestive heart failure, myocardial infarction,
restenosis and/or atherosclerosis after heart surgery or after carotid artery balloon
angioplastic procedures, silent myocardial ischemia, left ventricular pump dysfunction,
post implantation complications of left ventricular assist devices, Raynaud's phenomena,
thrombophlebitis, vasculitis including Kawasaki's vasculitis, veno-occlusive disease,
giant cell arteritis, Wegener's granulomatosis, and Schoenlein-Henoch purpura, but
that is not claimed. The receptor binding agent can also be provided prophylactically,
e.g., to reduce risk of such cardiovascular disorder, but that is not claimed. For
example, the receptor binding agent is administered to a patient to treat atherosclerosis
or to reduce risk thereof, but that is not claimed.
[0185] IL-1 mediated signaling is activated by acute myocardial infarction and can initiate
apoptotic cell death in the peri-infarct myocardial cells, extending the size of the
infarct zone. A receptor binding agent described herein can be administered to reduce
damage caused by myocardial infarction, but that is not claimed. For example, the
receptor binding agent can be administered to a subject who is at risk for a myocardial
infarction, or a subject who has experienced a myocardial infarction, particularly
an acute myocardial infarction, e.g., within the last 2, 4, 6, 12, 24, or 48 hours,
but that is not claimed. The agent can be administered in combination with other agents,
including, e.g., heparin and aspirin.
[0186] A receptor binding agent can also be used to treat stroke, sub-arachnoid hemorrhage,
head trauma or brain injury, and/or inflammation associated with a cardiovascular
disorder, but that is not claimed. For example, elevated levels of IL-1β have been
implicated in neuroinflammation associated with stroke and brain injury (
Rothwell, N. J., et al., TINS 23(12): 618-625, 2000). The receptor binding agent can be administered to reduce such inflammation and
other inflammation associated with ischemia and/or hypoxia, but that is not claimed.
In addition, the receptor binding agent can also be provided prophylactically, e.g.,
to reduce risk of such disorders and/or inflammation associated with such disorders,
but that is not claimed. For example, the receptor binding agent can be administered
a subject who is at risk for a stroke, an ischemic event, other cardiovascular event,
or a hemorrhagic event (such as a sub-arachnoid hemorrhage), or a subject who has
experienced a stroke, an ischemic event, other cardiovascular event, or a hemorrhagic
event (such as a sub-arachnoid hemorrhage), e.g., within the last 2, 4, 6, 12, 24,
or 48 hours, but that is not claimed.
[0187] Genitourinary and Renal Disorders. Disorders of the genitourinary system can also be treated with a receptor binding
agent described herein, but that is not claimed. Such disorders include glomerulonephritis,
including autoimmune glomerulonephritis, glomerulonephritis due to exposure to toxins
or glomerulonephritis secondary to infections with haemolytic streptococci or other
infectious agents. Immune mediated renal diseases, including glomerulonephritis and
tubulointerstitial nephritis, are the result of antibody or T lymphocyte mediated
injury to renal tissue either directly as a result of the production of autoreactive
antibodies or T cells against renal antigens or indirectly as a result of the deposition
of antibodies and/or immune complexes in the kidney that are reactive against other,
non-renal antigens. Thus other immune-mediated diseases that result in the formation
of immune-complexes can also induce immune mediated renal disease as an indirect sequelae.
Both direct and indirect immune mechanisms result in inflammatory response that produces/induces
lesion development in renal tissues with resultant organ function impairment and in
some cases progression to renal failure. Both humoral and cellular immune mechanisms
can be involved in the pathogenesis of lesions.
[0188] A receptor binding agent can also be used to treat uremic syndrome and its clinical
complications (for example, renal failure, anemia, and hypertrophic cardiomyopathy),
including uremic syndrome associated with exposure to environmental toxins, drugs
or other causes, but that is not claimed. Complications that arise from inflammation
of the gallbladder wall that leads to alteration in absorptive function can also be
treated, but that is not claimed. Included in such complications are cholelithiasis
(gallstones) and choliedocholithiasis (bile duct stones) and the recurrence of cholelithiasis
and choliedocholithiasis. Further conditions that can be treated are complications
of hemodialysis; prostate conditions, including benign prostatic hypertrophy, nonbacterial
prostatitis and chronic prostatitis; and complications of hemodialysis, but that is
not claimed. A receptor binding agent can also be used to treat chronic pain conditions,
such as chronic pelvic pain, including chronic prostatitis/pelvic pain syndrome, and
post-herpetic pain, but that is not claimed.
[0189] Hematologic and Oncologic Disorders. As defined in the accompanying claims, the invention provides a pharmaceutical composition
for use in treating cancer, which includes various forms of cancer, including acute
myelogenous leukemia, chronic myelogenous leukemia, Epstein-Barr virus-positive nasopharyngeal
carcinoma, glioma, colon, stomach, prostate, renal cell, cervical and ovarian cancers,
lung cancer (SCLC and NSCLC), including cancer-associated cachexia, fatigue, asthenia,
paraneoplastic syndrome of cachexia and hypercalcemia. See, e.g.,
Voronov et al. (2003) PNAS 100:2645-2650. Solid tumors, including sarcoma, osteosarcoma, and carcinoma, such as adenocarcinoma
(for example, breast cancer) and squamous cell carcinoma are also treatable. Regarding
the role of IL-1β in certain tumors, see e.g.,
Krelin et al. (2007) Cancer Res. 67:1062-1071. Additional cancers include esophogeal cancer, gastric cancer, gall bladder carcinoma,
leukemia, including acute myelogenous leukemia, chronic myelogenous leukemia, myeloid
leukemia, chronic or acute lymphoblastic leukemia and hairy cell leukemia. Other malignancies
with invasive metastatic potential, including multiple myeloma, can be treated with
the receptor binding agents. See, e.g.,
Lust et al. (2009) Mayo Clin Proc 84(2):114-122.
[0190] A receptor binding agent can also be used to treat anemias and hematologic disorders,
including chronic idiopathic neutropenia, anemia of chronic disease, aplastic anemia,
including Fanconi's aplastic anemia; idiopathic thrombocytopenic purpura (ITP); thrombotic
thrombocytopenic purpura, myelodysplastic syndromes (including refractory anemia,
refractory anemia with ringed sideroblasts, refractory anemia with excess blasts,
refractory anemia with excess blasts in transformation); myelofibrosis/myeloid metaplasia;
and sickle cell vasocclusive crisis, but that is not claimed.
[0191] Autoimmune hemolytic anemia, immune pancytopenia, and paroxysmal nocturnal hemoglobinuria
can result from production of antibodies that react with antigens expressed on the
surface of red blood cells (and in some cases other blood cells including platelets
as well) and is a consequence of the removal of those antibody coated cells via complement
mediated lysis and/or ADCC/Fc-receptor-mediated mechanisms. In autoimmune thrombocytopenia
including thrombocytopenic purpura, and immune-mediated thrombocytopenia in other
clinical settings, platelet destruction/removal occurs as a result of either antibody
or complement attaching to platelets and subsequent removal by complement lysis, ADCC
or FC-receptor mediated mechanisms.
[0192] As defined in the accompanying claims, the invention provides a pharmaceutical composition
for use in treating cancer, and can also be administered to subjects having or at
risk for various lymphoproliferative disorders, including autoimmune lymphoproliferative
syndrome (ALPS), chronic lymphoblastic leukemia, hairy cell leukemia, chronic lymphatic
leukemia, peripheral T-cell lymphoma, small lymphocytic lymphoma, mantle cell lymphoma,
follicular lymphoma, Burkitt's lymphoma, Epstein-Barr virus-positive T cell lymphoma,
histiocytic lymphoma, Hodgkin's disease, diffuse aggressive lymphoma, acute lymphatic
leukemias, T gamma lymphoproliferative disease, cutaneous B cell lymphoma, cutaneous
T cell lymphoma (i.e., mycosis fungoides) and Sezary syndrome.
[0193] Hepatic Disorders. The receptor binding agents disclosed herein are also useful for treating conditions
of the liver such as hepatitis, including acute alcoholic hepatitis, acute drug-induced
or viral hepatitis, hepatitis A, B and C, sclerosing cholangitis, hepatic sinusoid
epithelium, and inflammation of the liver due to unknown causes, but that is not claimed.
[0194] Hearing Disorders. Receptor binding agents can also be used to treat disorders that involve hearing
loss and that are associated with abnormal IL-1 expression, but that is not claimed.
Such disorders include cochlear nerve-associated hearing loss that is thought to result
from an autoimmune process, e.g., autoimmune hearing loss, Ménière's syndrome and
cholesteatoma, a middle ear disorder often associated with hearing loss.
[0195] Bone Disorders. Non-arthritic disorders of the bones and joints and also treatable with the receptor
binding agents described herein, but that is not claimed. This encompasses inflammatory
disorders of the bone or joint, osteoclast disorders that lead to bone loss, such
as but not limited to osteoporosis, including post-menopausal osteoporosis, osteoarthritis,
periodontitis resulting in tooth loosening or loss, and prosthesis loosening after
joint replacement (generally associated with an inflammatory response to wear debris),
e.g., orthopedic implant osteolysis.
[0196] Amyloid Disorders. Further, the receptor binding agents described herein can be used to treat primary
amyloidosis and the secondary amyloidosis that is characteristic of various conditions,
including Alzheimer's disease, secondary reactive amyloidosis; Down's syndrome; and
dialysis-associated amyloidosis, but that is not claimed. In addition, receptor binding
agents can be used to treat Amyotrophic lateral sclerosis (ALS), Huntington's disease,
and Parkinson's disease, but that is not claimed. These diseases can also involve
formation of aggregates and amyloids that can trigger inflammatory responses.
[0197] Neurological Disorders. Receptor binding agents can also be used to treat neuroinflammation and demyelinating
diseases of the central and peripheral nervous systems, including multiple sclerosis;
idiopathic demyelinating polyneuropathy or Guillain-Barre syndrome; and chronic inflammatory
demyelinating polyneuropathy, but that is not claimed. These disorders are believed
to have an autoimmune basis and result in nerve demyelination as a result of damage
caused to oligodendrocytes or to myelin directly. In multiple sclerosis disease induction
and involve T lymphocytes. Multiple sclerosis has either a relapsing-remitting course
or a chronic progressive course. Lesions contain infiltrates of predominantly T lymphocyte
mediated, microglial cells and infiltrating macrophages; CD4
+ T lymphocytes are the predominant cell type at lesions. The mechanism of oligodendrocyte
cell death and subsequent demyelination is not known but is likely T lymphocyte driven.
[0198] Myopathies. Receptor binding agents can be used to treat myopathies associated with inflammation
and autoimmunity, but that is not claimed. Idiopathic inflammatory myopathies including
dermatomyositis, polymyositis and others are disorders of chronic muscle inflammation
of unknown etiology resulting in muscle weakness. Muscle injury/inflammation is often
symmetric and progressive. Autoantibodies are associated with most forms. These myositis-specific
autoantibodies are directed against and inhibit the function of components, proteins
and RNA's, involved in protein synthesis.
[0199] Vasculitis Disorders. A receptor binding agent described herein can be used to treat a vasculitis disorder,
e.g., a systemic vasculitis, but that is not claimed. Systemic vasculitis includes
diseases in which the primary lesion is inflammation and subsequent damage to blood
vessels which results in ischemia/necrosis/degeneration to tissues supplied by the
affected vessels and eventual end-organ dysfunction in some cases. Vasculitides can
also occur as a secondary lesion or sequelae to other immune-inflammatory mediated
diseases such as rheumatoid arthritis, systemic sclerosis, etc., particularly in diseases
also associated with the formation of immune complexes.
[0200] Diseases in the primary systemic vasculitis group include: systemic necrotizing vasculitis:
polyarteritis nodosa, allergic angiitis and granulomatosis, polyangiitis; Wegener's
granulomatosis; lymphomatoid granulomatosis; and giant cell arteritis. Miscellaneous
vasculitides include: mucocutaneous lymph node syndrome (MLNS or Kawasaki's disease),
isolated CNS vasculitis, Behcet's disease, thromboangiitis obliterans (Buerger's disease)
and cutaneous necrotizing venulitis. The pathogenic mechanism of these vasculitis
disorders is believed to be primarily due to the deposition of immunoglobulin complexes
in the vessel wall and subsequent induction of an inflammatory response either via
ADCC, complement activation, or both.
[0201] CAPS. A receptor binding agent can be used to treat a CAPS disorder, i.e., CIAS1 Associated
Periodic Syndromes, but that is not claimed. CAPS includes three genetic syndromes:
Neonatal Onset Multisystem Inflammatory Disorder (NOMID), Muckle-Wells Syndrome (MWS),
and Familial Cold Auto inflammatory Syndrome (FCAS). (
Hoffman et al. 2001 Naure 29:301-305;
Feldmann et al. 2002 Am J Hum Genet 71:198-203;
Aksentijevich et al. 2002 Arthritis Rheum 46:3340-3348). CAPS are inherited in an autosomal dominant manner with a sporadic or familial
pattern. CIAS1 encodes NALP3, a protein component of the "inflammasome", a subcellular
enzyme complex that regulates the activity of caspase 1. Mutations in CIAS1 lead to
increased production of IL-1 and numerous pathological consequences (Aksentijevich
et al. 2002 supra). IL-1 strongly induces the production of acute phase reactants
in the liver, such as C-reactive protein (CRP) and serum amyloid A (SAA).
[0202] CAPS disorders share common clinical features and present as a spectrum of clinical
severity. NOMID is the most seriously disabling, MWS somewhat less so and FCAS is
the least severe. CAPS disorders have several overlapping features and individuals
can have unique constellations of signs and symptoms. Features common to all these
conditions include fevers, urticaria-like rash, arthritis or arthralgia, myalgia,
malaise, and conjunctivitis.
[0203] In NOMID, chronic aseptic meningitis may lead to mental retardation and these patients
may also suffer disfiguring and disabling bony overgrowth at the epiphyses and patellae.
These patients may also suffer blindness due to optic nerve atrophy that results from
increased intracranial pressure. MWS and NOMID are commonly associated with severe
inflammation that may include the auditory system, meninges, and joints. These patients
may suffer daily high spiking fevers and a chronic rash that frequently changes in
distribution and intensity. Patients may suffer hearing loss or deafness. Conjunctivitis
and papilledema are frequently observed. Amyloidosis may develop and lead to renal
failure due to chronic inflammation and overproduction of acute phase reactants (particularly
SM). A receptor binding agent can be administered to a subject having NOMID, MWS,
or FCAS or diagnosed as have a genotype associated with NOMID, MWS, or FCAS, but that
is not claimed. In addition, a receptor binding agent can be administered to a subject
having TRAPS (TNF receptor associated periodic syndrome), but that is not claimed.
[0204] Dermatological disorders. A receptor binding agent can be used to treat a dermatological disorder, such as
an inflammatory dermatological disorder or an autoimmune or immune-mediated skin disease,
but that is not claimed. An exemplary disorder is psoriasis. Additional autoimmune
or immune-mediated skin disease including bullous skin diseases, erythema multiforme,
and contact dermatitis are mediated by auto-antibodies, the genesis of which is T
lymphocyte-dependent, but that is not claimed. Psoriasis is a T lymphocyte-mediated
inflammatory disease. Lesions contain infiltrates of T lymphocytes, macrophages and
antigen processing cells, and some neutrophils.
[0205] Additional disorders of the skin or mucous membranes that can be treated include
acantholytic diseases, including Darier's disease, keratosis follicularis and pemphigus
vulgaris, but that is not claimed. Further additional disorders include: acne, acne
rosacea, alopecia areata, aphthous stomatitis, bullous pemphigoid, burns, eczema,
erythema, including erythema multiforme and erythema multiforme bullosum (Stevens-Johnson
syndrome), inflammatory skin disease, lichen planus, linear IgA bullous disease (chronic
bullous dermatosis of childhood), loss of skin elasticity, mucosal surface ulcers,
including gastric ulcers, neutrophilic dermatitis (Sweet's syndrome), dermatomyositis,
pityriasis rubra pilaris, psoriasis, pyoderma gangrenosum, multicentric reticulohistiocytosis,
and toxic epidermal necrolysis. Other skin related conditions treatable by receptor
binding agents include dermatitis herpetiformis (Duhring's disease), atopic dermatitis,
contact dermatitis, and urticaria (including chronic idiopathic urticaria), but that
is not claimed.
[0206] Allergic Disorders. A receptor binding agent can be used to treat an allergic disorder, such as asthma,
allergic rhinitis, atopic dermatitis, food hypersensitivity, allergic conjunctivitis
(see also below) and urticaria, but that is not claimed. These diseases are frequently
mediated by T lymphocyte induced inflammation, IgE mediated-inflammation, or both.
[0207] Asthma is a chronic condition involving the respiratory system in which the airway
occasionally constricts, becomes inflamed, and is lined with excessive amounts of
mucus, often in response to one or more triggers. Episodes may be triggered by such
things as exposure to an environmental stimulant (or allergen) such as cold air, warm
air, moist air, exercise or exertion, emotional stress, and viral illness. Airway
narrowing causes symptoms such as wheezing, shortness of breath, chest tightness,
and coughing. A receptor binding agent can be used to treat asthma and can be formulated
for topical or pulmonary delivery for such treatment or can be delivered parenterally,
but that is not claimed.
[0208] Transplantation. A receptor binding agent can be administered to a subject that is about to undergo,
is undergoing, or is recovering from a transplantation, but that is not claimed. Transplantation
associated diseases, including graft rejection and graft-versus-host-disease (GVHD),
are T lymphocyte-dependent; inhibition of T lymphocyte function is ameliorative. Corneal
transplantation can be associated with neovascularization which can be ameliorated
by treatment with a receptor binding agent, but that is not claimed. A receptor binding
agent can be also used to treat complications resulting from solid organ transplantation,
such as heart, liver, skin, kidney, lung (lung transplant airway obliteration) or
other transplants, including bone marrow transplants, but that is not claimed.
[0209] Infectious Diseases. The receptor binding agents described herein are useful for treating protozoal diseases,
including malaria and schistosomiasis and to treat erythema nodosum leprosum; bacterial
or viral meningitis; tuberculosis, including pulmonary tuberculosis; and pneumonitis
secondary to a bacterial or viral infection including influenza infection and infectious
mononucleosis, but that is not claimed.
[0210] Also treatable with a receptor binding agent are inherited periodic fever syndromes,
including familial Mediterranean fever, hyperimmunoglobulin D and periodic fever syndrome
and TNF-receptor associated periodic syndromes (TRAPS), and Adult-onset Still's disease,
Schnitzler's syndrome, and fibrosing alveolitis, but that is not claimed.
[0211] A receptor binding agent may be administered to a subject to reduce activity or expression
of IL-6 in the subject, but that is not claimed. For example, the subject can have
a disorder that is associated or mediated at least in part by IL-6.
Ocular Disorders and Ocular Delivery
[0212] The receptor binding agents described herein can be used to treat ocular disorders,
including ocular disorders affecting the surface of the eye, inflammatory ocular disorders,
and ocular disorders mediated at least in part by an autoimmune reaction, but that
is not claimed.
[0213] For example, the ocular disorder is a dry eye disorder that affects the surface of
the eye. The disorder includes conditions also referred to keratoconjunctivitis sicca,
keratitis sicca, sicca syndrome, xerophthalmia, tear film disorder, decreased tear
production, aqueous tear deficiency, and Meibomian gland dysfunction. Dry eye can
include forms that are associated with Sjögren's syndrome (SS), e.g., Sjögren's syndrome
associated keratoconjunctivitis sicca, but also forms that are not so associated,
e.g., non- Sjögren's syndrome associated keratoconjunctivitis sicca. The patient may
or may not have other manifestations of a systemic autoimmune disorder. IL-1 has been
implicated in the pathogenesis of dry eye disorders. See, e.g.,
Enriquez de Salamanca et al. (2010), Mol. Vis. 16:862-873.
[0214] Subjects having a dry eye syndrome can exhibit inflammation of the eye dry, and can
experience scratchy, stingy, itchy, burning or pressured sensations, irritation, pain,
and redness. Dry eye can be associated with both excessive eye watering and conversely
insufficient tear production. A receptor binding agent can be administered to such
subjects to ameliorate or prevent the onset or worsening of one or more such symptoms,
but that is not claimed. A receptor binding agent can also be used to mitigate pain,
e.g., ocular pain, such as due to neuroinflammation, in a subject who is experiencing
such pain, but that is not claimed.
[0215] For example, the ocular disorder is an ocular disorder associated with a systemic
autoimmune disorder (such as Sjögren's syndrome and rheumatoid arthritis) or with
a disorder associated with IL-1 or another IL-1 cytokine family member. The patient
may or may not have a systemic autoimmune disorder or other manifestations of a systemic
autoimmune disorder.
[0216] A receptor binding agent can also be used to treat other disorders affecting the
surface of the eye, such as the cornea, but that is not claimed. Such disorders include
corneal ocular surface inflammatory conditions, corneal neovascularization, keratitis,
including peripheral ulcerative keratitis and microbial keratitis. The receptor binding
agent can be used to treat a subject undergoing corneal wound healing (e.g., a subject
having a corneal wound) , but that is not claimed. A receptor binding agent can be
administered to a subject who is about to receive, undergoing, or recovering from
a procedure involving the eye, e.g., corneal transplantation/ keratoplasty, keratoprosthesis
surgery, lamellar transplantation, selective endothelial transplantation, but that
is not claimed. See, e.g.,
Dana (2007) Trans Am Ophthalmol Soc 105: 330-43;
Dekaris et al. (1999) Curr Eye Res 19(5): 456-9; and
Dana et al. (1997) Transplantation 63:1501-7. A receptor binding agent can be used to treat disorders affecting the conjunctiva,
including conjunctival scarring disorders and conjunctivitis, but that is not claimed.
The receptor binding agent can be used to treat still other disorders such as pemphigoid
syndrome and Stevens-Johnson syndrome, but that is not claimed. A receptor binding
agent described herein can be administered to a subject to modulate neovascularization
in or around the eye, but that is not claimed. See, e.g.,
Dana (2007) Trans Am Ophthalmol Soc 105: 330-43.
[0217] A receptor binding agent can be administered to a subject having an allergic reaction
affecting the eye, e.g., a subject experiencing severe allergic (atopic) eye disease
such as allergic conjunctivitis, but that is not claimed. For example, the receptor
binding agent can be administered topically, but that is not claimed. See also, e.g.,
Keane-Myers AM et al. (1999) Invest Ophthalmol Vis Sci, 40(12): 3041-6.
[0218] A receptor binding agent can be administered to a subject having an autoimmune disorder
affecting the eye, but that is not claimed. Exemplary autoimmune ocular disorders
include sympathetic ophthalmia, Vogt-Koyanagi Harada (VKH) syndrome, birdshot retinochoriodopathy,
ocular cicatricial pemphigoid, Fuchs' heterochronic iridocyclitis, and various forms
of uveitis.
[0220] Uveitis includes acute and chronic forms and includes inflammation of one or more
of the iris, the ciliary body, and the choroid. Chronic forms may be associated with
systemic autoimmune disease, e.g., Behcet's syndrome, ankylosing spondylitis, juvenile
rheumatoid arthritis, Reiter's syndrome, and inflammatory bowel disease. In anterior
uveitis, inflammation is primarily in the iris (also iritis). Anterior uveitis can
affect subjects who have systemic autoimmune disease, but also subjects who do not
have systemic autoimmune disease. Intermediate uveitis involves inflammation of the
anterior vitreous, peripheral retina, and ciliary body, often with little anterior
or chorioretinal inflammation. Pan planitis results from inflammation of the pars
plana between the iris and the choroid. Posterior uveitis involves the uveal tract
and primarily the choroid, and is also referred to as choroiditis. Posterior uveitis
can be associated with a systemic infection or an autoimmune disease. It can persist
for months and even years. A receptor binding agent can be administered to a subject
to treat any of the foregoing forms of uveitis, but that is not claimed. See also
e.g.,
Tsai et al. (2009) Mol Vis 15:1542-1552 and
Trittibach P et al. (2008) Gene Ther. 15(22): 1478-88.
[0221] A receptor binding agent may be used to treat a subject having or at risk for age-related
macular degeneration (AMD) , but that is not claimed. The receptor binding agent can
be applied topically to the eye, injected (e.g., intravitreally) or provided systemically,
but that is not claimed. See, e.g.,
Olson et al. (2009) Ocul Immunol Inflamm 17(3):195-200.
[0222] A receptor binding agent described herein can be administered by any mode to treat
an ocular disease, but that is not claimed. The agent can be delivered by a parenteral
mode. Alternatively or in addition, the agent can be delivered directly to the eye
or in the vicinity of the eye. For example, the protein can be administered topically
or intraocularly, e.g., as described below.
Formulations and Methods for Ocular Delivery
[0223] Ophthalmic formulations as defined in the claims can be delivered for topical administration,
e.g., for administration as a liquid drop or an ointment, or for implantation, e.g.,
into an anterior chamber of the eye or the conjunctival sac. Liquid drops can be delivered
using an eye dropper. When formulated for ocular delivery, the receptor binding agent
as defined in the claims can be present at 0.0001- 0.1%, 0.001-5%, e.g., 0.005-0.5%,
0.05 - 0.5%, 0.01-5%, 0.1-2% or 1%-5% concentration. Frequently the ophthalmic formulation
is applied directly to the eye including topical application to the eyelids or instillation
into the space (cul-de-sac) between the eyeball and the eyelids. The ophthalmic formulation
can be designed to mix readily with the lacrimal fluids and spread over the surfaces
of the cornea and conjunctiva. With the usual technique of administration, the major
portion of the drug is deposited in the lower fornix. Capillarity, diffusional forces,
and the blinking reflex drive incorporation of the drug in the precorneal film from
which it penetrates into and through the cornea.
[0224] Ophthalmic formulations can also include one or more other agents, e.g., an anti-inflammatory
steroid such as rimexolone, loteprednol, medrysone and hydrocortisone, or a non-steroidal
anti-inflammatory. For example, the steroid can be present at a concentration of 0.001
to 1%. In some embodiments, no steroid is present. For example, the receptor binding
agent as defined in the claims is the only active agent in the formulation.
[0225] The formulation can also include one or more of the following components: surfactants,
tonicity agents, buffers, preservatives, co-solvents and viscosity building agents.
Tonicity agents can be used to adjust the tonicity of the composition, e.g., to that
of natural tears. For example, potassium chloride, sodium chloride, magnesium chloride,
calcium chloride, dextrose and/or mannitol may be added to achieve an appropriate
tonicity, e.g., physiological tonicity. Tonicity agents can be added in an amount
sufficient to provide an osmolality of about 150-450 mOsm or 250-350 mOsm.
[0226] The formulation can also include buffering suitable for ophthalmic delivery. The
buffer can include one or more buffering components (e.g., sodium phosphate, sodium
acetate, sodium citrate, sodium borate or boric acid) to changes in pH especially
under storage conditions. For example, the buffer can be selected to provide a target
pH within the range of pH 6.0-7.5, e.g., 6.5-7.5.
[0227] The formulation can include an aqueous or phospholipid carrier. Particularly for
treating dry eye disorders, the formulation can include agents to provide short-term
relief, e.g., compounds which lubricate the eye and assist in tear formation. For
example, phospholipid carriers (which include one or more phospholipids) can be used
to provide short-term relief. Examples or artificial tears compositions useful as
artificial tears carriers include commercial products such as Tears Naturale
™ (Alcon Labs, Inc., TX USA). For example, per ml, the formulation can include: 1 mg
dextran, 70 and 3 mg hydroxypropyl methylcellulose, and optionally a preservative
such POLYQUAD
® (polyquaternium-1) 0.001% (m/v). Examples of phospholipid carrier formulations include
those disclosed in
US 4,804,539,
US 4,883,658,
US 5,075,104,
US 5,278,151, and
US 5,578,586.
[0228] The formulation can also include other compounds that act as a lubricant or wetting
agent. These include viscosity agents such as: monomeric polyols, such as, glycerol,
propylene glycol, ethylene glycol; polymeric polyols, such as polyethylene glycol,
various polymers of the cellulose family: hydroxypropylmethyl cellulose ("HPMC"),
carboxy methylcellulose sodium, hydroxy propylcellulose ("HPC"), dextrans, such as
dextran 70; water soluble proteins, such as gelatin; and vinyl polymers, such as polyvinyl
alcohol, polyvinylpyrrolidone, povidone and carbomers, such as carbomer 934P, carbomer
941; carbomer 940, carbomer 974P. Still additional examples include polysaccharides,
such as hyaluronic acid and its salts and chondroitin sulfate and its salts, and acrylic
acid polymers. In certain embodiments, the formulation has a viscosity between 1 to
400 cP.
[0229] The formulation can be packaged for single or multi-dose use, e.g., in a bottle with
an associated dropper or as a set of single-use droppers. The formulation can include
one or more preservatives, e.g., to prevent microbial and fungal contamination during
use. Exemplary preservatives include: benzalkonium chloride, chlorobutanol, benzododecinium
bromide, methyl paraben, propyl paraben, phenylethyl alcohol, edetate disodium, sorbic
acid, and polyquaternium-1, and can be included at a concentration of from 0.001 to
1.0% w/v. It is also possible to provide a formulation containing a receptor binding
agent that is sterile yet free of preservatives. The formulation can be prepared for
single use application.
[0230] Ophthalmic packs may be used to give prolonged contact of an ophthalmic formulation
with the eye. A cotton pledget is saturated with the formulation and then inserted
into the superior or inferior fornix. A receptor binding agent may also be administered
by the way of iontophoresis, but that is not claimed. This procedure keeps the solution
in contact with the cornea in an eyecup bearing an electrode. Diffusion of the drug
is effected by difference of electrical potential.
[0231] A receptor binding agent may also be delivered by injection, e.g., subconjunctival
injection, but that is not claimed. The formulation can be injected underneath the
conjunctiva facilitating passage through the sclera and into the eye by simple diffusion.
The formulation can also be injected underneath the conjunctiva and the underlying
Tenon's capsule in the more posterior portion of the eye to deliver the agent to the
ciliary body, choroid, and retina. The formulation may also be administered by retrobulbar
injection, but that is not claimed.
[0232] With respect to dry eye and other surface disorders, subjects can be evaluated using
one or more of the following approaches: the Ocular Surface Disease Index (OSDI),
corneal and conjunctival staining, and the Schirmer test.
[0233] The Ocular Surface Disease Index (OSDI) is a 12-item questionnaire that provides
a rapid assessment of the symptoms of ocular irritation consistent with ocular surface
inflammatory disorders, including DES, and their impact on vision-related functioning.
See e.g.
Ocul Immunol Inflamm. 2007 Sep-Oct;15(5):389-93. The 12 items of the OSDI questionnaire are graded on a scale of 0 to 4. Scores are
derived based on responses to provide an OSDI score on a scale of 0 to 100, with higher
scores representing greater disability. A negative change from baseline indicates
an improvement in vision-related function and the ocular inflammatory disorders.
[0234] Corneal and Conjunctival Staining: Corneal staining is a measure of epithelial disease,
or break in the epithelial barrier of the ocular surface, typically seen with ocular
surface inflammatory disorders such as dry eye. Corneal staining can exist even without
clinically evident dry eye, if there is significant lid disease, such as posterior
blepharitis. Corneal staining is highly correlated with ocular discomfort in many,
though not all patients; in general corneal staining is associated with high scores
in the OSDI, as described above. For corneal fluorescein staining, saline-moistened
fluorescein strips or 1% sodium fluorescein solution are used to stain the tear film.
The entire cornea is then examined using slit-lamp evaluation with a yellow barrier
filter (#12 Wratten) and cobalt blue illumination. Staining is graded according to
the Oxford Schema. Conjunctival staining is likewise a measure of epithelial disease
or break in the epithelial barrier of the ocular surface. Conjunctival staining is
performed under the slit-lamp using lissamine green. Saline-moistened strip or 1%
lissamine green solution is used to stain the tear film, and interpalpebral conjunctival
staining is evaluated more than 30 seconds but less than 2 minutes later. Using white
light of moderate intensity, only the interpalpebral region of the nasal and temporal
conjunctival staining is graded using the Oxford Schema.
[0235] Schirmer Test: The Schirmer test is performed in the presence and in the absence
of anesthesia by placing a narrow filter-paper strip (5 × 3 5mm strip of Whatman #41
filter paper) in the inferior cul-de-sac. This test is conducted in a dimly lit room.
The patient gently closes his/her eyes until five minutes have elapsed and the strips
are removed. Because the tear front will continue advancing a few millimeters after
it has been removed from the eyes, the tear front is marked with a ball-point pen
at precisely five minutes. Aqueous tear production is measured by the length in millimeters
that the strip wets during 5 minutes. Results of 10 mm or less for the Schirmer test
without anesthesia and 5 mm or less for the Schirmer test with anesthesia are considered
abnormal. A positive change from baseline indicates improvement of one or more symptoms
of an ocular inflammatory disorder described herein.
Formulations and Methods for Pulmonary Delivery
[0236] A receptor binding agent as defined by the claims can be formulated for inhalatory
or other mode of pulmonary delivery, e.g., to administer the agent to a tissue of
the respiratory tract, e.g., the upper and lower respiratory tract. The three common
systems that can be used to deliver agents locally to the pulmonary air passages include
dry powder inhalers (DPIs), metered dose inhalers (MDIs) and nebulizers. MDIs may
be used to deliver receptor binding agents in a solubilized form or as a dispersion.
Typically MDIs include a freon or other relatively high vapor pressure propellant
that forces aerosolized medication into the respiratory tract upon activation of the
device. In contrast DPIs generally rely on the inspiratory efforts of the patient
to introduce a medicament in a dry powder form to the lungs. Nebulizers form a medicament
aerosol to be inhaled by imparting energy to a liquid solution. The agent can be stored
in a lyophilized form (e.g., at room temperature) and reconstituted in solution prior
to inhalation.
Direct pulmonary delivery of drugs during liquid ventilation or pulmonary lavage using
a fluorochemical medium are also possible delivery modes. These and other methods
can be used to deliver receptor binding agent, but that is not claimed. For example,
the agent is delivered in a dosage unit form of at least about 0.02, 0.1, 0.5, 1,
1.5, 2, 5, 10, 20, 40, or 50 mg/puff or more.
[0237] The receptor binding agent may be conveniently delivered in the form of an aerosol
spray presentation from pressurized packs or a nebulizer, with the use of a suitable
propellant, e.g., dichlorodifluoromethane, trichlorofluoromethane, dielilorotetrafluoroctliane,
carbon dioxide or other suitable gas. In the case of a pressurized aerosol, the dosage
unit may be determined by providing a valve to deliver a metered amount. Capsules
and cartridges for use in an inhaler or insufflator may be formulated containing a
powder mix of the receptor binding agent and a suitable powder base such as lactose
or starch, if the particle is a formulated particle. In addition to the formulated
or unformulated receptor binding agent, other materials such as 100% DPPC or other
surfactants can be mixed together to promote the delivery and dispersion of the formulated
or unformulated receptor binding agent. Particle size can also be varied to control
whether deliver is to the lower or upper respiratory tract. For example, particles
in the size range of 1-5 microns or 10-50 microns can be used for the lower and upper
respiratory tracts respectively.
[0238] Delivery enhancers such as surfactants can be used to further enhance pulmonary delivery.
A surfactant is generally a compound having a hydrophilic and lipophilic moiety, which
promotes absorption of a drug by interacting with an interface between two immiscible
phases. Surfactants are useful in the dry particles for several reasons, e.g., reduction
of particle agglomeration and reduction of macrophage phagocytosis. Surfactants are
well known in the art and include phosphoglycerides, e.g., phosphatidylcholines, L-alpha-phosphatidylcholine
dipalmitoyl (DPPC) and diphosphatidyl glycerol (DPPG); hexadecanol; fatty acids; polyethylene
glycol (PEG); polyoxyethylene-9-; auryl ether; palmitic acid; oleic acid; sorbitan
trioleate (Span 85); glycocholate; surfactin; poloxomer; sorbitan fatty acid ester;
sorbitan trioleate; tyloxapol; and phospholipids.
[0239] Also featured herein but not claimed are antibodies that specifically recognize a
chimeric cytokine domain described herein. For example, such antibodies preferentially
bind to a chimeric domain relative to any parental cytokine domain. For example, a
specific antibody can bind to an epitope that includes a junction between a segment
from a first parental cytokine and a second parental cytokine.
Nucleic Acid Delivery
[0240] A receptor-binding agent can be provided to a subject by delivering a nucleic acid
that encodes and can express the receptor-binding agent, but that is not claimed.
For example, a nucleic acid sequence encoding the receptor-binding agent can be placed
under control of transcription control sequences and positioned in a nucleic acid
vector for gene delivery, e.g., a viral vector, but that is not claimed. Exemplary
viral vectors include adenoviral, retroviral, or adeno-associated viral vectors. Vectors
can be in the form of a plasmid or linear molecule, e.g., a linear double stranded
DNA. The delivered nucleic acid can be designed to be incorporated into the genome
of the target cell, e.g., to integrate into the genome of the target cell. Alternatively,
the delivered nucleic acid can be designed such that after delivery it exists autonomously
in the cell.
[0241] Transcriptional control sequences can be engineered to provide transient or constitutive
expression. Transient control can include control regulated by an exogenous agent,
e.g., by using transcriptional response elements for transcription factors responsive
to exogenous agents (e.g., a steroid hormone or FK506) or environmental signals.
[0242] Expression of genes provided on the delivered nucleic acid can be evaluated, e.g.,
by detection of the protein encoded by the gene (e.g., using antibodies) or by detection
of the mRNA, e.g., using PCR or Northern hybridization. The delivered nucleic acid
is generally engineered so that transcriptional and translational regulatory DNA are
appropriately positioned relative to the coding sequence for the receptor-binding
agent such that transcription is initiated and that protein is translated from the
resulting message. The nucleic acid can include transcriptional and translational
regulatory nucleic acid sequences from mammalian cells, particularly humans. Such
sequences include, e.g., promoter sequences, ribosomal binding sites, transcriptional
start and stop sequences, translational start and stop sequences, and enhancer or
activator sequences.
[0243] In addition, the expression vector may include additional elements. For example,
for integrating expression vectors, the expression vector can contain at least one
or two sequences homologous to the host cell genome, e.g., flanking the expression
construct. The integrating vector may be directed to a specific locus in the host
cell by selecting the appropriate homologous sequence for inclusion in the vector.
Constructs for integrating vectors are well known in the art.
[0244] Exemplary adenoviral vectors include modified versions of human adenoviruses such
as Ad2 or Ad5, in which the genetic elements necessary for the virus to replicate
in vivo have been removed. For example, the E1 region can be removed and the genome
can be further modified to accept an expression cassette coding for the receptor-binding
agent.
[0245] Exemplary retroviral vectors include LNL6, LXSN, LNCX, and lentiviral vectors. Particular
lentiviral vectors are described by
Pawliuk et al. (2001) Science 294:2368 and
Imren et al. (2002) PNAS 99:14380 and include limited to, human immunodeficiency virus (e.g., HIV-1, HIV-2), feline
immunodeficiency virus (FIV), simian immunodeficiency virus (SIV), bovine immunodeficiency
virus (BIV), and equine infectious anemia virus (EIAV). These vectors can be constructed
and engineered to be safe, e.g., by separating the essential genes (e.g.,
gag and
pol) onto separate vectors and by rendering retrovirus replication defective. The replication
defective retrovirus is then packaged into virions through the use of a helper virus
or a packaging cell line, by standard techniques. Protocols for producing recombinant
retroviruses and for infecting cells in vitro or in vivo with such viruses can be
found in
Current Protocols in Molecular Biology, Ausubel, F. M. et al. (eds.) Greene Publishing
Associates, (1989), Sections 9.10-9.14 and other standard laboratory manuals. The retroviral vector
can include, in addition to sequences for expressing a receptor-binding agent, a left
(5') retroviral LTR; a retroviral export element, optionally a reverse response element
(RRE); a promoter, and a locus control region (LCR) or other transcriptional insulator
sequence and a right (3') retroviral LTR. Retroviral vectors can further contain a
central polypurine tract (cPPT) or DNA flap to increase viral titers and transduction
efficiency.
[0246] The nucleic acid containing a sequence encoding a receptor-binding agent can be delivered
to any appropriate target cells, e.g., ex vivo or in vivo, but that is not claimed.
Exemplary target cells include synovial cells, hematopoietic cells, dermal cells,
and so forth. The nucleic acid can be delivered to target cells associated with the
eye, e.g., corneal epithelial cells. Delivery may include the debridement, or scraping
of the corneal epithelium to expose a basal layer of epithelium. The nucleic acid
for delivery is then added. For example, the nucleic acid is delivered to corneal
endothelial cells, cells of the trabecular meshwork beneath the periphery of the cornea,
cells of the choroid layer of the eye, cells of the retina, sclera or ciliary body,
cells of the retinal or ocular vasculature, or cells of the vitreous body or cells
of the lens, for example the lens epithelium.
[0247] Delivery methods which are disclosed herein but not claimed include, e.g., retroviral
infection, adenoviral infection, transformation with plasmids, transformation with
liposomes containing exogenous nucleic acid, biolistic nucleic acid delivery (e.g.,
loading the nucleic acid onto gold or other metal particles and shooting or injecting
into the cells), adeno-associated virus infection and Epstein-Barr virus infection.
Delivery can be into cells or tissue by any method including needle injection, hypospray,
electroporation, or a gene gun.
[0248] Other methods for gene delivery can be found in, e.g.,
Kay, M. A. (1997) Chest 111(6 Supp.):138S-142S;
Ferry, N. and Heard, J. M. (1998) Hum. Gene Ther. 9:1975-81;
Shiratory, Y. et al. (1999) Liver 19:265-74;
Oka, K. et al. (2000) Curr. Opin. Lipidol. 11:179-86;
Thule, P. M. and Liu, J. M. (2000) Gene Ther. 7:1744-52;
Yang, N. S. (1992) Crit. Rev. Biotechnol. 12:335-56;
Alt, M. (1995) J. Hepatol. 23:746-58;
Brody, S. L. and Crystal, R. G. (1994) Ann. N.Y. Acad. Sci. 716:90-101;
Strayer, D. S. (1999) Expert Opin. Investig. Drugs 8:2159-2172;
Smith-Arica, J. R. and Bartlett, J. S. (2001) Curr. Cardiol. Rep. 3:43-49; and
Lee, H. C. et al. (2000) Nature 408:483-8.
Exemplary Second Agents
[0249] The invention provides a pharmaceutical composition as defined in the accompanying
claims for use in treating cancer. In that use, the receptor binding agent defined
in the claims can be administered with a second agent. The two agents can be co-administered,
or administered separately, e.g., using different regimes. Exemplary second agents
include an anti-inflammatory agent.
[0250] In one embodiment, the second agent is an IL-17 antagonist (encompassing antagonists
of all IL-17 family members, e.g., antagonists of IL-17A, IL-17F, IL-17B, IL-17C,
IL-17D, and IL-17E). Exemplary IL-17 antagonists include: agents (such as antibodies
and other binding proteins) that bind to IL-17 (including IL-17A, IL-17F, IL-17B,
IL-17C, IL-17D, and IL-17E) and which antagonize IL-17 mediated signaling; agents
(such as antibodies and other binding proteins) that bind to one or more receptors
for IL-17, such as IL-17RA and IL-17RC and which antagonize IL-17 mediated signaling;
agents (such as antibodies and other binding proteins) that bind to a complex containing
IL-17 and at least one receptor subunit, e.g., IL-17 and II-17RA, or IL-17, IL-17RA,
and IL-17RC and which antagonize IL-17 mediated signaling; and agents such as soluble
receptors that include one or more of soluble extracellular domains of IL-17RA and
IL-17RC and which antagonize IL-17 mediated signaling.
[0251] In another embodiment, the second agent is an IL-12 antagonist. Exemplary IL-12 antagonists
include: agents (such as antibodies and other binding proteins) that bind to IL-12
(including p35 and p40) and which antagonize IL-12 mediated signaling; agents (such
as antibodies and other binding proteins) that bind to one or more receptors for IL-12,
such as IL-12Rβ1 or IL-12Rβ2 and which antagonize IL-12 mediated signaling; agents
(such as antibodies and other binding proteins) that bind to a complex containing
p35, p40 and at least one receptor subunit, e.g., IL-12Rβ1 or IL-12Rβ2 and which antagonize
IL-12 mediated signaling; and agents such as soluble receptors that include one or
more of soluble extracellular domains of IL-12Rβ1 or IL-12Rβ2 and which antagonize
IL-12 mediated signaling.
[0252] In another embodiment, the second agent is an IL-23 antagonist. Exemplary IL-23 antagonists
include: agents (such as antibodies and other binding proteins) that bind to IL-23
(including p19 and p40) and which antagonize IL-23 mediated signaling; agents (such
as antibodies and other binding proteins) that bind to one or more receptors for IL-23,
such as IL-12Rβ1 or IL-23R and which antagonize IL-23 mediated signaling; agents (such
as antibodies and other binding proteins) that bind to a complex containing p19, p40
and at least one receptor subunit, e.g., IL-12Rβ1 or IL-23R and which antagonize IL-23
mediated signaling; and agents such as soluble receptors that include one or more
of soluble extracellular domains of IL-12Rβ1 or IL-23R and which antagonize IL-23
mediated signaling.
Animal Models
[0254] A receptor binding agent can be evaluated in an animal model for human disease, e.g.,
a human autoimmune and/or human inflammatory disease, but that is not claimed. The
agent can have specificity for the corresponding target protein in the animal.
[0255] Rheumatoid Arthritis Models. A receptor binding agent can be evaluated in an animal model of rheumatoid arthritis,
e.g., the collagen-induced arthritis (CIA) model, but that is not claimed. See, for
example,
Mclndoe et al., 1999, Proc. Natl. Acad. Sci. USA, 96:2210-2214;
Issekutz, A. C. et al., Immunology (1996) 88:569; and
Current Protocols in Immunology, Unit 15.5, Coligan et al. (eds.), John Wiley & Sons,
Inc. The model is produced by the immunization of susceptible strains of rat/mice with
native type II collagen. Collagen is emulsified in Complete Freund's Adjuvant (CFA)
and injected intradermally (100 µg collagen:100 µg CFA/mouse) at the base of the tail.
Control mice are injected intradermally with 0.05 ml of distilled water/CFA emulsion.
A booster injection of collagen in incomplete adjuvant is given 21 days after the
initial immunization. Disease is due to an autoimmune response induced upon immunization
with collagen.
[0256] The joints can be scored for arthritis, inflammation, pannus, cartilage damage and
bone resorption using a defined scale. For example the severity of arthritis can be
scored as follows: 0=no visible effects of arthritis; 1=edema and erythema of one
digit or joint; 2=edema and erythema of two joints; 3=edema and erythema of more than
two joint; 4=severe arthritis of the entire paw and digits, accompanied by ankylosis
of the ankle and deformity of the limb. The score for each limb is summed and recorded
as the arthritic index (Al) for each individual animal. Other scoring schemes can
also be used for these and other criteria.
[0257] Multiple Sclerosis. Experimental allergic encephalomyelitis (EAE) is a useful murine model for multiple
sclerosis. A receptor binding agent can be evaluated in the EAE model, but that is
not claimed. EAE is a T cell mediated autoimmune disorder characterized by T cell
and mononuclear cell inflammation and subsequent demyelination of axons in the central
nervous system. (See, for example,
Bolton, C., 1995, Multiple Sclerosis, 143.) Exemplary protocols can be found in
Current Protocols in Immunology, Unit 15.1 and 15.2; Coligan et al. (eds.), John Wiley
& Sons, Inc. Models are also available for myelin disease in which oligodendrocytes or Schwann
cells are grafted into the central nervous system, for example, as described in
Duncan et al., 1997, Molec. Med. Today, 554-561.
[0258] Allograft. A receptor binding agent can be evaluated in an animal model for skin allograft rejection,
e.g., using murine tail-skin grafts, but that is not claimed. Skin allograft rejection
is mediated by T cells, helper T cells and killer-effector T cells. See, for example,
Current Protocols in Immunology, Unit 4.4; Coligan et al. (eds.), 1995, John Wiley
& Sons, Inc. Other transplant rejection models can also be used. See, e.g.,
Tinubu et al., 1994, J. Immunol., 4330-4338.
[0259] IBD and Colitis Models. An exemplary model for inflammatory bowel disease is the use of CD4+ CD45Rb-high
cells transferred to SCID mice, but that is not claimed. See e.g.,
Hirano et al., J Pharmacol Sci. 2009 Jun;110(2):169-81 and the use of transgenic IL-10 deficient mice. See e.g.,
Inaba et al., Inflamm Bowel Dis., DOI: 10.1002/ibd.21253 (2010). Yet another exemplary colitis model employs dextran sulfate sodium (DSS) to induce
acute colitis, but that is not claimed. For example, colitis can be induced in mice
by administration of 5% (wt/vol) DSS (molecular mass 30-40 kDa; ICN Biomedicals, Aurora,
OH) in drinking water ad libitum. Symptoms resulting from this treatment bloody diarrhea,
weight loss, colon shortening and mucosal ulceration with neutrophil infiltration.
DSS-induced colitis is characterized histologically by infiltration of inflammatory
cells into the lamina propria, with lymphoid hyperplasia, focal crypt damage, and
epithelial ulceration. These changes are thought to develop due to a toxic effect
of DSS on the epithelium and by phagocytosis of lamina propria cells and production
of TNF-alpha and IFN-gamma. See, e.g.,
Hassan et al. PLoS One. 2010 Jan 25;5(1):e8868.
[0260] Dry Eye Disease Models. A receptor binding agent can be evaluated in a mouse model for dry eye disease, but
that is not claimed. Dry eye can be induced in mice by subcutaneous injection of scopolamine
and then placement of the mice in controlled-environment chambers. By way of a specific
example, normal healthy 6 to 10 weeks old female C57BL/6 mice can be induced to have
dry eye by continuous exposure to dry environment in a controlled environmental chamber.
The chamber has low relative humidity of less than 30% (generally about 19%), high
airflow (15 liters/minute) and constant temperature (about 22°C). The mice placed
in the chamber are also treated with scopolamine to inhibit tear secretion. Sustained-release
transdermal scopolamine patches can be obtained from Novartis (Summit, N.J.). One-fourth
of a patch is applied to the depilated mid-tail of mice every 48 hours. The combination
of the controlled environmental chamber and scopolamine produces severe dry eye in
a relative short period of time (about 2-4 days). The controlled environmental chamber
can be prepared as described in
Barbino et al., Invest. Ophthal. Vis. Sci., 46: 2766-2711 (2005), and enables control of air flow, humidity, and temperature.
[0261] Mice can be monitored for signs of dry eye, e.g., by performing: a) cotton thread
test to measure aqueous tear production, which is generally decreased in patients
with dry eye; b) corneal fluorescein staining which is a marker of corneal surface
damage; and general ophthalmic examination.
[0262] Cotton Thread Test: Tear production can be measured with cotton thread test, impregnated
with phenol red (Zone-Quick, Lacrimedics, Eastsound, Wash.). Under a magnifying fluorescent
lamp, the thread is held with jeweler forceps and placed in the lateral cantus of
the conjunctival fornix of the right eye for 30 or 60 seconds. The tear distance in
mm is read under a microscope using the scale of a hemacytometer.
[0263] Corneal Fluorescein Staining: Corneal fluorescein staining can be evaluated by applying
1.0 µl of 5% fluorescein by a micropipette into the inferior conjunctival sac of the
eye. The cornea is examined with a slit lamp biomicroscope using cobalt blue light
3 minutes after the fluorescein instillation. Punctuate staining is recorded in a
masked fashion using a standardized National Eye Institute (NEI) grading system of
0-3 for each of the five areas in which the corneal surface has been divided.
Diagnostic and Other Uses
[0264] A receptor binding agent described herein can be used to detect IL-1R1 in a sample,
or cells expressing such a receptor, but that is not claimed. For example, the agent
as defined in the appended claims can be labeled directly or indirectly with a moiety
that is a label or produces a signal, e.g., an enzyme, a radiolabel, an epitope, or
a fluorescent protein (such as green fluorescent protein). The agent can be contacted
to a sample or to cells to determine if the receptor is present in the sample or on
the cells, e.g., using standard immunoblotting, immunofluorescence, enzyme immunoassay
(EIA), radioimmunoassay (RIA), fluorescence energy transfer, Western blot, and other
diagnostic and detection techniques.
[0265] The receptor binding agent can also be labeled for in vivo detection and administered
to a subject, but that is not claimed. The subject can be imaged, e.g., by NMR or
other tomographic means. For example, the binding agent can be labeled with a radiolabel
such as
131I,
111In,
123I,
99mTc,
32P,
125I,
3H,
14C, and
188Rh, fluorescent labels such as fluorescein and rhodamine, nuclear magnetic resonance
active labels, positron emitting isotopes detectable by a positron emission tomography
("PET") scanner, chemiluminescers such as luciferin, and enzymatic markers such as
peroxidase or phosphatase. The agent can be labeled with a contrast agent such as
paramagnetic agents and ferromagnetic or superparamagnetic (which primarily alter
T2 response)
[0266] A receptor binding agent can also be used to purify cells which express the receptor
to which it binds, but that is not claimed. For example, the receptor binding agent
as defined in the appended claims can be coupled to an immobilized support (e.g.,
magnetic beads or a column matrix) and contacted to cells which may express the receptor.
The support can be washed, e.g., with a physiological buffer, and the cells can be
recovered from the support.
[0267] A receptor binding agent can also be used to purify soluble forms of the receptor
to which it binds, but that is not claimed. For example, samples containing the soluble
receptor can be contacted to immobilized receptor binding agent and then, e.g., after
washing, can be recovered from the immobilized agent.
[0268] The following non-limiting examples further illustrate embodiments of the inventions
described herein.
Examples
Example 1
[0271] The proteins can include a range of different residues from IL-1β and IL-1Ra as illustrated
below. Among the examples P01, P02, P03, P04, and P05, the cytokine domains can have
48-70% residues from IL-1β and 55-78% residues from IL-1Ra. (Because a number of amino
acid residues are conserved between the two proteins, the sum of the percentage identity
to IL-1β and to IL-1Ra can be greater than 100%.)
Table 6
| |
IL-1β residues |
IL-1RA residues |
Total residues |
% IL-1β |
% IL-1 RA |
| P06 |
130 |
62 |
152 |
85.5 |
40.8 |
| P07 |
113 |
80 |
153 |
73.9 |
52.3 |
| P05 |
108 |
85 |
153 |
70.6 |
55.6 |
| P04 |
104 |
89 |
153 |
68.0 |
58.2 |
| P03 |
94 |
99 |
153 |
61.4 |
64.7 |
| P02 |
85 |
108 |
153 |
55.6 |
70.6 |
| P01 |
74 |
119 |
153 |
48.4 |
77.8 |
Example 2
[0272] Proteins that contain a hexa-histidine tag were expressed in
E.
coli cells BL21(DES) strain by induction with 1 mM IPTG at 37°C for 3 hours in LB broth
media. The cells were lysed in 20-50 mM Tris, 0.5 M NaCl, 2.5 mM EDTA, 0.1% Triton
X-100, pH 8.0. Lysates were subjected to IMAC chromatography using a HiTrap
® pre-packed column (GE Healthcare, Piscataway NJ, USA). The protein was loaded in
20 mM sodium phosphate, 0.5 M NaCl 10 mM imidazole, pH 7.4 buffer. It was eluted with
200 mM imidazole, 20 mM sodium phosphate, 0.5 M NaCl pH 7.4 buffer. Eluted protein
was dialyzed extensively against PBS, 0.1% Polysorbate 80, pH 7.4, concentrated using
an Amicon Ultra
® (10K) filter, and stored at 4° or-80°C.
[0273] Proteins lacking a hexa-histidine tag were purified by ion exchange chromatography.
P05 protein was purified by ion exchange chromatography. Lysate from expressing cells
was applied to a GigaCapS
™ column (Tosoh Bioscience LLC, King of Prussia, PA, USA) at low pH (approximately
pH 5.5) in the absence of salt (conductivity approximately 1 mS/cm). The column was
then eluted by a pH gradient (Buffer A = 10 mM acetic acid, pH 5.5; Buffer B = 20
mM Tris pH 8). A 5 ml fraction containing the eluted protein was then diluted with
5 ml of H
2O and 5 ml of 20 mM Tris pH 8) and then applied to CaptoQ
™ resin (GE Healthcare, Piscataway NJ, USA) and eluted with a 0 mM to 250 mM NaCl gradient
in 20 mM Tris pH 8.0. The eluted protein was dialyzed extensively against 1.25 X PBS
0.1% TWEEN
® 80 or 1.25X PBS lacking TWEEN
® and stored. See Fig. 6. P03 and P04 proteins were purified using similar methods.
[0274] Cells expressing P05 were also grown in TEKNOVA
™ Terrific Broth with animal free soytone (# T7660) supplemented with 10 g/L glucose,
10 mM MgSO
4, trace elements (1 mg/ml TEKNOVA
™ 1000X Trace Elements, #T1001), and antibiotic in a Sartorius 2L BIOSTAT
™ A+ and were induced at OD 35-40 with 1 mM IPTG for about 6 hours. Cells are grown
at 37°C with 30% dissolved oxygen at pH 7.0, and agitation at 200-800 rpm with oxygen
sparge at 2L/min. Cells are fed 9 g glucose/L/hr when glucose is depleted as detected
by a pH increase. Feed is reduced to 6 g glucose/L/hr when the pH decreases (about
2.5 hrs after induction).
[0275] Cells were collected and lysed in lysis buffer (20 mM Tris, 10 mM EDTA, 0.1% Triton,
pH 8.0; 20 mM Tris, 10 mM EDTA, 0.1% Triton, pH 7.0; 50 mM MOPS, 10 mM EDTA, 0.1%
Triton, pH 6.5; or 50 mM MOPS, 10 mM EDTA, 0.1% Triton, pH 6.0). Lysate is loaded
onto Poros XS
® cation ion exchange media (Life Technologies Corp., Carlsbad CA USA) at pH 5.3 and
3 mS/cm (35 mg product per ml column resin).
[0276] In an exemplary procedure, P05 protein is eluted by a step to pH 7.0 using buffer
containing 100 mM MOPS 25 mM NaCl pH 7.0. The first eluting peak was discarded, and
the second eluting peak was collected in pools and contained P05 protein. Early pools
are enriched for intact P05 protein relative to a des-Ala species. This eluted material
is then flowed over CaptoQ
™ anion exchange resin. The flow through, which contains intact P05 protein, is collected.
[0277] In another exemplary procedure, the media is washed with 100 mM MOPS 20 mM NaCl pH
6.0. P05 protein is eluted by a step to pH 6.0 using buffer containing 100 mM MOPS
50-58 mM NaCl pH 6.0. The first eluting peak was separated from subsequent peaks and
contained intact P05 protein. This eluted material is then flowed over CaptoQ
™ anion exchange resin. The flow through, which contains intact P05 protein, is collected.
Example 3
[0278] The proteins or supernatants containing the proteins were evaluated in a cell-based
assay for IL-1 activity. HEK-Blue
™ IL-1β responsive cells were used to monitor IL-1β activity (available from InvivoGen
Inc., San Diego CA, USA). These cells include a SEAP reporter gene under the control
of the IFN-β minimal promoter fused to five NF-κB and five AP-1 binding sites. IL-1β
engagement of IL-1 receptors on the cell surface lead to NF-κB activation and SEAP
production. The SEAP report can be detected, e.g., using QUANTI-Blue
™ (InvivoGen Inc., San Diego CA, USA) and spectrophotometric analysis. A HEK-Blue IL-1β
cell suspension was prepared from cells cultured to 70-80% confluence. The resuspended
cells were adjusted to ~330,000 cells/ml in fresh growth medium (DMEM, 4.5 g/l glucose,
2 mM L-Glutamine, 10% (v/v) heat-inactivated fetal bovine serum (30 min at 56°C),
50 U/ml penicillin, 50 µg/ml streptomycin, 100 µg/ml NormocinT).
[0279] Reagents were added to wells of a flat-bottom 96-well cell culture plate: 10 µl of
IL-1β at 20 ng/ml, 1□ µl of the agent of interest and 30 µl of cell culture medium
to a final volume of 50 µl. Positive and negative controls samples were prepared in
parallel. Then 150 µl of HEK-Blue IL-1β cell suspension (~50,000 cells) was added
to each well and the plate was cultured overnight at 37°C in 5% CO
2 tissue culture incubator. Generally the final IL-1β concentration (in the 200 µl
final volume) was 0.1 ng/ml. IL-1β activity was evaluated the next day (12-15 hours
later). Prior to quantitation, the QUANTI-Blue
™ reagent was prepared according to the manufacturer's instructions. A flat bottomed
96-well assay plate was prepared in which 150 µl of QUANTI-Blue
™ solution was added to each well. 50 µl of conditioned media from the wells of the
96 well tissue culture plate was added to each well of the assay plate. The plate
was incubated at 37°C for approximately 15-20 minutes. SEAP levels were then measured
using a spectrophotometer at 620-655 nm.
[0280] Results. As shown in FIG. 7A, in this assay, the P06 protein behaved as an IL-1RI agonist,
the P07 protein behaved as a partial agonist, and the P01 protein failed to agonize.
In fact, the P01 protein behaved as an antagonist when assayed in the presence of
IL-1β. Fic. 7B shows antagonism of IL-1β activity by P01 at a range of IL-1β protein
concentrations using the HEKBlue
™ cell assay above. Antagonism increased with increasing amounts of P01 (x-axis reflects
microliters of supernatant containing P01).
[0281] The proteins P01, P02, P03, P04, and P05 each antagonized IL-1β activity. See FIG.
8A and 8B, for example. The IC50 of P05 was less than about 5 ng/ml. P05 was test
for ability to agonize IL-1RI in this assay and was not observed to have any detectable
agonistic activity even at the highest concentrations tested, 1 mg/ml. P01, P02, P03,
P04, and P05 also inhibited IL-1β induced IL-6 expression in MG-63 cells, a human
osteosarcoma cell line that is responsive to IL-1β. In a murine model of dry eye disease,
hexa-histidine tagged P05 was observed to have biological activity. See also Example
8 below regarding untagged P05.
Example 4
[0282] The binding properties of proteins for soluble recombinant human IL-1RI (corresponding
to the extracellular domain of IL-1RI) were evaluated using surface plasmon resonance
with a Reichert SR7000DC Dual Channel SPR system. Binding was evaluated in phosphate
buffered saline with 0.005% Tween 20. IL-1β was observed to have a K
D of between 8-9 nM and a dissociation constant (K
d) of between 2-3 × 10
-3 s
-1, and in another experiment a K
D of about 2 nM, an association constant of 1.3-1.5 × 10
6 M
-1s
-1, and a dissociation constant (K
d) of about 2.9-3.0 × 10
-3 s
-1. See Fig. 9A. The P01 protein bound with similar association kinetics as IL-1β, but
did not dissociate during of the dissociation phase of the binding experiment (about
180 seconds). Thus, the P01 protein bound to IL-1RI with a greater affinity than did
IL-1β under similar conditions.
[0283] Binding of IL-1Ra was observed to have a K
D of about 0.33 nM, an association constant (K
a) of about 2 × 10
5 M
-1s
-1, and a dissociation constant (K
d) of about 6.6× 10
-5 s
-1. See Fig. 9B. Chimeric cytokine domains P01, P02, P03, P04, and P05 were observed
to have K
D ranging from about 12-1700 pM, an association constant (K
a) ranging from about 3 × 10
4 M
-1s
-1 to 3 × 10
6 M
-1s
-1, and a dissociation constant (K
d) ranging from about 2 × 10
-5 to 1 × 10
-3 s
-1. See for example Fig. 9C and 9D and Table 7 below.
Table 7
| Protein |
ka (M-1s-1) |
Kd (s-1) |
KD (pM) |
| IL-1β |
1.47 × 106 M-1s-1 |
2.95 × 10-3 s-1 |
2010 |
| IL-1Ra |
2.01 × 105 M-1s-1 |
6.58× 10-5 s-1 |
326 |
| P01 |
4.93 × 104 M-1s-1 |
2.32 × 10-5 s-1 |
470 |
| P02 |
3.39 × 104 M-1s-1 |
2.16 × 10-5 s-1 |
636 |
| P03 |
4.1 × 106 M1s-1 |
1.2 × 10-3 s-1 |
290 |
| P04 |
3.00 × 104 M1s-1 |
5.14 × 10-4 s-1 |
1714 |
| P05 |
3.47 × 106 M1s-1 |
4.15 × 10-5 s-1 |
12 |
| P06 |
4.8 × 106 M1s-1 |
1.7 × 10-3 s-1 |
410 |
| P07 |
1.58 × 104 M1s-1 |
1.46 × 10-3 s-1 |
92553 |
Example 5
[0285] The polypeptide below is a chimeric domain that includes at least two segments from
IL-1α and at least two segments from IL-1 Ra.

Example 6
[0286] A circularly permuted IL-1 chimeric domain can be constructed by linking the N-terminus
to the C-terminus of the molecule using a linker sequence and selecting a new location
for each of the termini. For proteins having termini derived from IL-1β, the linker
length can be between five to ten, e.g., about seven amino acids. Preferred locations
for new termini are in loops which face away from the receptors, such as the β6-β7
loop (e.g., amino acids corresponding to 71-80 of SEQ ID NO:1) or the β7-β8 loop (e.g.,
amino acids corresponding to 84-99 of SEQ ID NO:1).
[0287] Examples of such circularly permuted IL-1 chimeric domains include:

and

Example 7
[0288] Proteins P03, P04, P05, mIL-1Ra (methionyl IL-1Ra), and IL-1β were prepared in phosphate-buffered
saline (PBS), pH 7.4, at 0.5 mg/ml. The proteins were combined with SYPRO orange dye
(Invitrogen, CA) at a 1:500 dilution of the stock concentration and subject to differential
scanning fluorimetry. See, e.g.,
He et al. (2010) J. Pharm. Sciences, 99 1707-1720. Fluorescence measurements were monitored using an Agilent Mx3005 QPCR machine as
the temperature was increased from 25°C to 95°C at a rate of 1°C per minute. Melting
temperature (T
m) values were derived from the maxima value of the first derivative of the fluorescence
transition. The proteins P03, P04, and P05 were observed to have an onset of unfolding
of greater than 50°C and as high as 59°C, and T
m of greater than 59, 60, 62, and 64°C. Results are shown in Table 8 below and FIG.
10A & 10B:
Table 8
| Protein |
Tm (°C) |
Onset of unfolding (°C) |
| mlL-1Ra |
56 |
48 |
| IL-1β |
56 |
41 |
| P03 |
65 |
59 |
| P04 |
60 |
51 |
| P05 |
65 |
59 |
[0289] P04 has a T
m that is about 4 degrees higher than mIL-1Ra and IL-1β and exhibits an onset of unfolding
about 3 degrees higher than mlL-1Ra and about 10 degrees higher than IL-1β. P03 and
P05 have a T
m that is about 9 degrees higher than mlL-1Ra and IL-1β and exhibit an onset of unfolding
about 11 degrees higher than mIL-1Ra and about 18 degrees higher than IL-1β.
Example 8
[0290] Purified P05 (lacking a hexa-histidine tag) was prepared in 1.25x PBS and tested
in a murine model of dry eye disease. In this model, female C57BL/6 mice 6 to 10 weeks
of age from Jackson Laboratories (acclimated 1 to 2 weeks in an animal holding room
with ≥30% relative humidity, hydrogel food supplement, and envirodry environment enrichment)
were pre-screened for fluorescein staining on Day 0. For fluorescein staining, freshly
made fluorescein diluted in WFI H
2O at 10 mg/mL was administered at 0.4 µL to each eye. Approximately 8-13 minutes after
administration, eyes were scored using an Olympus fluorescent dissecting microscope.
Punctuate staining was recorded using the standardized National Eye Institute (NEI)
grading system of 0-3 for each of the five areas into which the corneal surface has
been divided (score range 0-15/eye). Using a teaching bridge, two masked scorers evaluated
mice at the same time to give a single collective score for each eye.
[0291] Mice with scores ≤ 7 for each eye (out of a maximal score of 15) were placed in a
dry eye chamber (20%± 2% humidity and constant air flow ~21 L/min/cage) on day 1 and
were maintained in this chamber during the course of the experiment (except for examination).
On day 3, mice were scored again and randomized into treatment groups with 8 to 10
mice/group. Mice were randomized such that each cage of 4 to 5 mice had approximately
the same mean disease score. Beginning on day 3 and after randomization, mice were
topically administered P05 or vehicle (1.25X PBS) in an eye drop at 3 µL/eye BID frequency.
Mice were examined and scored on days 7, 9, and 11 for corneal fluorescein staining
as described above. Scorers were blinded as to the treatment groups during the course
of the experiment.
[0292] Fic. 11A is a bar graph of mean corneal staining score ± SEM at day 0, 3, 7, 9, and
11 for mice from two identical experiments under the following bid treatments: no
treatment, vehicle (1.25X PBS), and 10 mg/ml (1%) P05. 10 mg/ml P05 significantly
reduced corneal staining on days 7, 9, and 11 of the experiment. Efficacy as evaluated
by a reduction in corneal staining was also observed with doses as low as 0.1 mg/ml
P05. Recombinant IL-1Ra produced in E.
coli also moderately reduced corneal staining in the animal model.
[0293] As shown in FIG. 11B, the effect of 10 mg/ml P05 was specific based on a comparison
to 10 mg/ml murine serum albumin in the same vehicle. No effect was seen with 10 mg/ml
murine serum albumin (MSA) relative to vehicle, and the effect of 10 mg/ml P05 was
statistically significant relative to 10 mg/ml murine serum albumin. As shown in FIG.
11C, 10 mg/ml P05 was also compared to 0.05% cyclosporine in an ophthalmic emulsion
(Restasis
®). Whereas P05 reduced corneal staining, no effect was observed for the 0.05% cyclosporine
ophthalmic emulsion after ~1 week of bid dosing.
Example 9
[0294] A capture step has been developed for the purification of P05 produced by fermentation
in BLR(DE3)
E.
coli cells. The elution conditions were defined through a statistical design of experiment
approach (DOE) on a 1 mL column. The optimized conditions were performed on an intermediate
scale (10 mL column).
[0295] The product is extracted by microfluidization in a lysis buffer consisting of 20
mM Tris at pH 7.0 with 10 mM EDTA added. The clarified lysate is adjusted to a pH
of 5.3 and a conductivity of 3 mS/cm. The conditioned lysate is loaded onto a PorosXS
(strong cation exchange resin) with a 2 min residence time to a capacity of 25-30
mg P05/mL column. The column is washed with equilibration buffer to remove unbound
species. A second wash at pH 6.0 and 3 mS/cm is implemented to remove a population
of impurities. The product is eluted at pH 6.0 and 6.6 mS/cm. A product related species
is eluted at pH 6.0 and 12.4 mS/cm. The column is cleaned with a high salt buffer
and NaOH.
[0296] P05 is a 17 kDa protein with a pl of 6.58. The pl of the des-ALA species is 6.8 and
is readily resolved by analytical weak cation exchange chromatography. This species
is likely to be a product of aminopeptidase P activity found in
E.
coli. The species can be identified by mass spectroscopy, peptide mapping, and HPLC methods.
[0297] Chromatographic Materials. PorosXS is based on a crosslinked poly(styrenedivinylbenzene) bead with a nominal
50 µm particle size. The chromatographic matrix has sulfopropyl surface chemistry
and was designed to tolerate elevated levels of salt during binding. The PorosXS (
CN 4404339, Life Technologies) material was procured as a bulk slurry and packed into a 5×50
mm Tricorn column (
CN 28-4064-09, GE Healthcare) with a final column volume of 1 mL (5 cm bed height) or into a 10×150
mm Tricorn column (
CN 28-4064-16, GE Healthcare) packed to a final volume of 10.5 mL (13.4 cm bed height).
[0298] Buffers. All buffers were prepared with MilliQ water volumetrically. To reach the desired
pH, either 10 N HCl or 1 M NaOH (made from a stock solution of 10 M NaOH) was added
to titrate the buffer. After preparation, all buffers were filtered through 0.2 µm
PES bottle top filters. All pH and conductivity measurements were performed at room
temperature (~ 20-25°C).
[0299] PorosXS Buffers: CEX equilibration buffer - 10 mM acetic acid (HoAC) with 21 mM NaCl
made by adding 0.57 mL of glacial acetic acid and 2.44 g of NaCl per L of buffer.
The final pH was 5.3 and the final conductivity was 3 mS/cm.
[0300] CEX wash buffer - 100 mM MOPS with 22 mM NaCl made by adding 19.5 g of MOPS free
acid, 1.5 g of MOPS sodium salt, and 1.28 g of NaCl per L of buffer. The final pH
was 5.7-6.6 (as desired) and the final conductivity was 3 mS/cm.
[0301] CEX elution buffer - 100 mM MOPS with 118 mM NaCl made by adding 19.5 g of MOPS free
acid, 1.5 g of MOPS sodium salt, and 6.93 g of NaCl per L of buffer. The final pH
was 5.7-6.6 (as desired) and the final conductivity was 12.4 mS/cm.
[0302] CEX strip buffer - 10 mM acetic acid with 3 M NaCl made by adding 0.57 mL of glacial
acetic acid and 175 g of NaCl per L of buffer. The final pH was 5.3 and the final
conductivity was 188 mS/cm.
[0303] Lysate preparation. The pH of the lysate was adjusted using 200 mM acetic acid at pH 4.5 made by mixing
11.5 mL of glacial acetic acid per L of buffer. The solution was titrated to a final
pH of 4.5 using 1 M NaOH. This solution was used in order to avoid localized precipitation
due to low pH of concentrated or strong acids.
[0304] The load material for these experiments was an extract from a 2 L fed-batch bioreactor
run. The extraction of the product from the cell pellet was performed using 20 mM
Tris at pH 7.0 with 10 mM EDTA added. The fresh extract was diluted to a conductivity
of 3 mS/cm with MilliQ water (typically 1:1-1.5 dilution). The diluted extract was
frozen at -20°C in 41 mL aliquots. To prepare the load, an aliquot was thawed at room
temperature and titrated to pH 5.3 using 200 mM acetic acid at pH 4.5. Small adjustments
in conductivity were made by addition of MilliQ water when needed after titration.
Finally, the load was diluted 2.5× to a concentration of ~1.7 g/L using CEX equilibration
buffer. The load was sterile filtered through a 0.8/0.2 µm filter. The conditioned
load was used the same day as prepared.
[0305] Host Cell Protein Determination. The host cell protein (HCP) levels were determined by an enzyme-linked immunosorbent
assay (ELISA) kit specific for an
E.
coli expression system (CN F410, Cygnus Technologies). The protocol supplied with the
kit was followed exactly. Samples to be assayed for HCP levels were diluted using
sample diluent (CN I028, Cygnus Technologies) with a minimum dilution of 10×. Samples
were typically run at two dilutions and plated in duplicate for each dilution. The
level of HCP is represented in terms of parts per million (ppm) or ng-HCP/mg-product.
[0306] SDS-PAGE Analysis. For purity analysis by sodium dodecyl sulfate polyacrylamide gel electrophoresis
(SDS-PAGE), either 1 mm×10 well or 1 mm×15 well NuPAGE 4-12% BisTris gels (CN NP0322Box
and NP0323Box, respectively, Invitrogen) are used. The running buffer is 1× MES SDS
running buffer prepared from a 20× concentration (CN NP0002, Invitrogen). Novex sharp
prestained protein standards (CN 57318, Invitrogen) are used as molecular weight indicators.
Samples for analysis were prepared by dilution with MilliQ water to a final volume
of 30 µL and 10 µL of 4× Lithium dodecyl sulfate (LDS) (CN NP0008, Invitrogen) was
added to a final concentration of 1×. The samples were mixed by vortex for 5 s. Based
on the calculated protein concentration from the A280/A320 measurement, a target of
3 µg per well was loaded.
[0307] wCEX. P05 was evaluated by weak cation exchange chromatography (wCEX) using a Dionex ProPac
® WCX-10 4x250 mm column (Product Number 054993), with a flow rate of 1.2 mL/min using
mobile phase solutions of 10 mM sodium acetate pH 5.5 (buffer A) and 10 mM sodium
acetate pH 5.5, 250 mM NaCl (buffer B). A gradient is performed from 10%B to 25%B
over 20 minutes. Intact P05 elutes approximately 1.5 to 2.5 minutes before the des-Ala
species in the later part of the gradient.
[0308] Cation Exchange Capture Chromatography. Chromatography was performed on an AKTA Explorer 100 chromatography system. A 10
mL PorosXS column was packed. Material was loaded at 40 mg of P05/ml, or can be loaded
at 25-30 mg of P05/ml. The chromatography method is summarized in Table 9. The residence
time was held constant during loading and elution steps at 2 min. Mock elution pools
were made and assayed for product recovery, HCP level, and % intact protein. A total
of 2 runs were completed on the 10 mL column with %B at 30% and 35% at pH 6.0.
Table 9
| Step |
Column volumes (CV) |
Buffer |
| Equilibration |
10 |
10 mM HoAC + 21 mM NaCl pH 5.3 |
| Load |
40 |
Conditioned lysate, 3 mS/cm pH 5.3 |
| Wash #1 |
5-10 |
10 mM HoAC + 21 mM NaCl pH 5.3 |
| Wash #2 |
9-10 |
100 mM MOPS + 22 mM NaCl pH 6.0 (3 mS/cm) |
| Elution #1 |
30 |
100 mM MOPS + 22 mM NaCl pH 6.0 (3 mS/cm) blended with 30-35% 100 mM MOPS + 118 mM
NaCl pH 6.0 |
| Elution #2 |
6 |
100 mM MOPS + 118 mM NaCl pH 6.0 |
| Strip |
5-6 |
10 mM HoAC + 3 M NaCl pH 5.3 |
| Clean |
20 |
1 M NaOH |
| Neutralization (NaCl) |
10 |
100 mM MOPS + 118 mM NaCl pH 6.0 |
| Re-equilibration |
20 |
10 mM HoAC + 21 mM NaCl pH 5.3 |
[0309] Wash #2 results in a peak comprised mainly of impurities. Elutions #1 with 30% and
35% B result in >95% pure product by SDS-PAGE analysis. The salt concentration of
Wash #2 can be increased by a small amount to remove the shoulder on the elution peak.
Example 10
[0310] P04 was purified, and diffraction quality crystals were grown in 25% PEG1500, 0.1
M PCB (pH 4.0) at 20°C. The protein crystallized in the space group P2
12
12
1, with typical unit cell dimensions of a = 44.5, b = 46.4, c = 64.8. The crystals
diffracted to high resolution, and a dataset extending to 1.47 Å was collected at
the Advanced Photon Source, beamline LS-CAT 21ID-F (Chicago IL, USA). The X-ray structure
of P04 was solved by molecular replacement using a model incorporating the relevant
portions of known IL-1β and IL-1Ra structures from PDB structures 1ITB and 1IRA (
Vigers et al., (1997) Nature 386: 190-194 and
Schreuder et al., (1997) Nature 386: 194-200). The final model was refined to a R
work/R
free of 17.6%/20.4% and contains one P04 molecule (140 residues) and 98 water molecules
(Table 10). P04 residues 1-2, 48-49 and 85-93 were not visible in the electron density
and are missing in the final model.
Table 10
| Crystallographic Data Collection and Refinement Statistics |
| Data Collection Statistics |
|
| Space group |
P212121 |
| Cell dimensions |
|
| |
a, b, c (Å) |
44.5, 46.4, 64.8 |
| |
α, β, γ (°) |
90, 90, 90 |
| Wavelength (Å) |
0.9787 |
| Resolution (Å) |
50.0 - 1.47 (1.52 - 1.47) |
| Rmerge |
0.039(0.56) |
| l/σl |
37.7 (2.9) |
| Completeness (%) |
99.8 (100) |
| Redundancy |
6 (5.9) |
| Refinement Statistics |
|
| Resolution (Å) |
28.64 - 1.47 (1.53 - 1.47) |
| No. of reflections |
22926 |
| Rwork/Rfree |
17.6/20.4 |
| Average B (Å) |
22.3 |
| Rmsd bond lengths (Å) |
0.007 |
| Rmsd bond angles (°) |
1.137 |
Numbers in parentheses correspond to highest resolution shell
Rmerge = Σ hkl [ Σ i | Ii - <I> | / Σ iIi]
Rwork = Σ hkl ∥ Fobs | - | Fcalc ∥/ Σ hkl | Fobs | where Fobs and Fcalc are the observed and calculated structure factors
Rfree was calculated from a subset of reflections (5%) not used for refinement. |
[0311] The P04 crystal structure has a fold similar to that predicted by the modeling. A
view of this structure is shown in FIG. 1. An overlay of the two structures is shown
in FIG. 12A. The RMSD for backbone carbons was 1.41 Å and 1.09 Å for the IL-1β and
IL-1Ra segments versus the same residues on the respective parent molecules. P04 has
at least one unique salt bridge and two unique hydrogen bonds that involve an interaction
between a residue derived from IL-1β and a counterpart derived from IL-1Ra: (i) Glu39-Lys64
(Glu39 from IL-1RA; Lys64 from IL-1β) as shown in FIG. 12B, (ii) Arg9-Gln149 (Arg9
from IL-1RA; Gln149 from IL-1β) as shown in FIG. 12C and (iii) Ser152-Lys40 (Ser152
from IL-1RA; Lys50 from IL-1β) as shown in FIG. 12C. These unique interactions can
explain P04's increased thermal stability as these interactions are absent in the
IL-1β and IL-1Ra structures. The residues involved in these interactions are also
present in P03 and P05, proteins that likewise have increased thermal stability.