BACKGROUND
[0001] Human immunodeficiency virus (HIV) infection and related diseases are a major public
health problem worldwide. Most currently approved therapies for HIV infection target
the viral reverse transcriptase, protease enzymes, and integrase but resistance of
HIV to these existing drugs, long term toxicity, and lack of patient adherence to
daily dosing regimens have proven to be problems associated with these therapies.
Therefore, it is important to discover and develop new HIV drugs.
[0002] WO 2009/066702,
WO 2012/030904,
WO 2014/063059,
WO 2016/149698,
WO 2017/106346;
WO 2018/075564 and
WO 2018/125813,
McCoy, Retrovirology (2018) 15:70;
Sok and Burton, Nat Immunol. 2018 19(11):1179-1188;
Possas, et al., Expert Opin Ther Pat. 2018 Jul;28(7):551-560; and
Stephenson and Barouch, Curr HIV/AIDS Rep (2016) 13:31-37 describe human anti-HIV antibodies derived from memory B cells of HIV-infected donors,
which target the V3 glycan region of gp120, and are capable of inhibiting infection
by HIV-1 species from a plurality of clades. The therapeutic use of the antibodies
may be limited due to the need to identify patients infected with HIV-1 species that
can be targeted by HIV gp120 V3 glycan region antibodies.
WO 2012/030904 describes human immunodeficiency virus (HIV)-neutralizing antibodies.
Wang H, et al. describes the evaluation of susceptibility of HIV-1 CRF01_AE variants
to neutralization by a panel of broadly neutralizing antibodies (Archives of Virology,
vol. 163, no.12, (2018-09-08), pages 3303-3315).
SUMMARY
[0003] The invention provides an antibody or antigen-binding fragment thereof that comprises
VH and VL regions that bind to an epitope of HIV gp120 within the third variable loop
(V3) comprising a N332 oligomannose glycan for use in a method of treating or preventing
HIV in a human subject in need thereof, wherein the human subject is infected with
an HIV or a population of HIV expressing an HIV gp120 comprising the following amino
acid residues: N332glycan, D325, L179 and H330, wherein the amino acid positions are
with reference to SEQ ID NO: 4, and wherein the antibody or antigen-binding fragment
thereof comprises a VH and a VL comprising the amino acid sequences set forth, respectively,
in:
| i. |
SEQ ID NOs.: 400 and 401; |
| ii. |
SEQ ID NOs.: 402 and 404; or |
| iii. |
SEQ ID NOs.: 405 and 406. |
[0004] The invention further provides an
in vitro method of identifying a human subject infected with an HIV or a population of HIV
sensitive to an antibody or antigen-binding fragment thereof that comprises VH and
VL regions that bind to an epitope of HIV gp120 within the third variable loop (V3)
comprising a N332 oligomannose glycan, the method comprising identifying in a biological
sample from the human subject an HIV expressing an HIV gp120 that has been determined
via polynucleotide or polypeptide sequencing to comprise the following amino acid
residues: N332glycan, D325, L179 and H330, wherein the amino acid positions are with
reference to SEQ ID NO: 4, and wherein the antibody or antigen-binding fragment thereof
comprises a VH and a VL comprising the amino acid sequences set forth, respectively,
in:
| i. |
SEQ ID NOs.: 400 and 401; |
| ii. |
SEQ ID NOs.: 402 and 404; or |
| iii. |
SEQ ID NOs.: 405 and 406. |
[0005] Any references to methods of treatment by therapy or surgery or diagnosis methods
in this description are to be interpreted as references to the compounds, pharmaceutical
compositions and medicaments of the present invention for use in those methods.
[0006] Provided are methods of treatment and
in vitro methods of identifying patients most likely to benefit from therapy with an antibody
targeting the V3 glycan region of HIV gp120, as defined by the claims.
[0007] Accordingly, in one embodiment of the invention, provided is an antibody or antigen-binding
fragment thereof as defined by the claims for use in methods of treating or preventing
HIV in a human subject in need thereof, wherein the human subject who is infected
with an HIV or a population of HIV expressing a gp120 comprising the following amino
acid residues: a glycosylated asparagine at the position corresponding to amino acid
residue position 332 (N332glycan), an aspartate at the position corresponding to amino
acid residue position 325 (D325), a leucine at the position corresponding to amino
acid residue position 179 (L179), a histidine at the position corresponding to amino
acid residue position 330 (H330), and one or more amino acid residues selected from
the group consisting of: a threonine at the position corresponding to amino acid residue
position 63 (T63), and a threonine at the position corresponding to amino acid residue
position 320 (T320), wherein the amino acid positions are with reference to SEQ ID
NO: 4, and wherein the antibody or antigen-binding fragment thereof comprises a VH
and a VL comprising the amino acid sequences set forth, respectively, in:
| i. |
SEQ ID NOs.: 400 and 401; |
| ii. |
SEQ ID NOs.: 402 and 404; or |
| iii. |
SEQ ID NOs.: 405 and 406. |
[0008] In the claimed invention, the subject is infected with an HIV or a population of
HIV expressing a gp120 comprising the following amino acid residues: N332glycan, D325,
L179 and H330, wherein the amino acid positions are with reference to SEQ ID NO: 4.
[0009] In some embodiments of the claimed invention, the subject is infected with an HIV
or a population of HIV expressing a gp120 comprising the following amino acid residues:
i. N332glycan, D325, T63, L179 and H330 or ii. N332glycan, D325, L179, T320 and H330;
or iii. N332glycan, D325, T63, L179, T320 and H330, wherein the amino acid positions
are with reference to SEQ ID NO: 4.
[0010] Disclosed but not within the literal scope of the claims, the subject may be infected
with an HIV or a population of HIV expressing a gp120 comprising the following amino
acid residues: i. N332glycan, D325 and T63; ii. N332glycan, D325 and L179; iii. N332glycan,
D325 and T320; iv. N332glycan, D325 and H330; v. N332glycan, D325, T63 and L179; vi.
N332glycan, D325, T63 and T320; vii. N332glycan, D325, T63 and H330; viii. N332glycan,
D325, L179 and T320;; ix. N332glycan, D325, T320 and H330; x. N332glycan, D325, T63,
T320 and H330; or xi. N332glycan, D325, T63, L179 and T320, wherein the amino acid
positions are with reference to SEQ ID NO: 4. Disclosed but not within the literal
scope of the claims, the subject may be infected with an HIV or a population of HIV
expressing a gp120 comprising the following amino acid residues: i. N332glycan, D325
and T63; ii. N332glycan, D325 and L179; iii. N332glycan, D325 and T320; or iv. N332glycan,
D325 and H330, wherein the amino acid positions are with reference to SEQ ID NO: 4.
Disclosed but not within the literal scope of the claims, the subject may be infected
with an HIV or a population of HIV expressing a gp120 comprising the following amino
acid residues: i. N332glycan, D325, T63 and L179; ii. N332glycan, D325, T63 and T320;
iii. N332glycan, D325, T63 and H330; iv. N332glycan, D325, L179 and T320;; or v. N332glycan,
D325, T320 and H330, wherein the amino acid positions are with reference to SEQ ID
NO: 4. Disclosed but not within the literal scope of the claims, the subject may be
infected with an HIV or a population of HIV expressing a gp120 comprising the following
amino acid residues: i. N332glycan, D325, T63, T320 and H330; or ii. N332glycan, D325,
T63, L179 and T320, wherein the amino acid positions are with reference to SEQ ID
NO: 4. Disclosed but not within the literal scope of the claims, the subject may be
infected with an HIV or a population of HIV expressing a gp120 comprising the following
amino acid residues: i. N332glycan, D325, T63 and H330; or ii. N332glycan, D325, T320
and H330, wherein the amino acid positions are with reference to SEQ ID NO: 4. In
some embodiments, the subject is infected with an HIV or a population of HIV expressing
a gp120 further comprising one or more of the following amino acid residues: a glycan
at amino acid residue 301 (glycan301); a lysine at amino acid residue 677 (K677);
an amino acid residue other than tryptophan (
e.g., A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V or Y) at position 17 (not_W17);
an amino acid residue other than arginine (
e.g., A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W or Y) at position 747 (not_R747);
an insertion_321.01 (
e.g., an insertion of any amino acid (
e.g., A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W or Y) between position G321
and K322); a glutamic acid at position 429 (E429); a glutamine at position 442 (Q442);
an arginine at position 335 (R335); an isoleucine at position 165 (I165); a serine
at position 393 (S393); an isoleucine at position 307 (I307); a glycan at position
295 (295 glycan); and/or an asparagine at position 300 (N300), wherein the amino acid
positions are with reference to SEQ ID NO: 4. In some embodiments, at least 90%,
e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least
96%, at least 97%, at least 98%, at least 99%, or 100%, of the HIV species in the
population of HIV comprise the recited amino acid residues.
[0011] In the claimed invention, the administered antibody or antigen-binding fragment thereof
comprises VH and VL regions from an antibody selected from the group consisting of
GS-9722 (elipovimab), PGT-121 and 10-1074.
[0012] Disclosed but not within the literal scope of the claims, the administered antibody
or antigen-binding fragment thereof may compete with or comprise VH and VL regions
from an antibody selected from the group consisting of GS-9721, PGT-121.66, PGT-121.414,
PGT-122, PGT-123, PGT-124, PGT-125, PGT-126, PGT-128, PGT-130, PGT-133, PGT-134, PGT-135,
PGT-136, PGT-137, PGT-138, PGT-139, 10-1074-J, VRC24, 2G12, BG18, 354BG8, 354BG18,
354BG42, 354BG33, 354BG129, 354BG188, 354BG411, 354BG426, DH270.1, DH270.6, PGDM12,
VRC41.01, PGDM21, PCDN-33A, BF520.1 and VRC29.03. Disclosed but not within the literal
scope of the claims, the antibody or antigen-binding fragment thereof may compete
with or comprise VH and VL regions from an antibody selected from the group consisting
of GS-9721, , PGT-121.66, PGT-121.414, PGT-124, PGT-134, GS-2872, 10-1074-J, PGT-122
and PGT-123.
[0013] In some embodiments of the claimed invention, the anti-HIV gp120 V3 glycan directed
antibody or antigen-binding fragment thereof, as defined by the claims, for use in
in a method of treating or preventing HIV comprises an Fc region comprising one or
more amino acid substitutions that extend serum half-life. In some embodiments, the
anti-HIV gp120 V3 glycan directed antibody or antigen-binding fragment thereof, as
defined by the claims, for use in in a method of treating or preventing HIV comprises
an Fc region comprising the following amino acids at the indicated positions (EU index
numbering): i. Tyrosine at position 252, threonine at position 254 and glutamic acid
at position 256 (YTE); or ii. Leucine at position 428 and serine at position 434 (LS).
In some embodiments, the anti-HIV gp120 V3 glycan directed antibody or antigen-binding
fragment thereof, as defined by the claims, for use in in a method of treating or
preventing HIV comprises an Fc region comprising the following amino acids at the
indicated positions (EU index numbering): i. Aspartate at position 239 and glutamate
at position 332 (DE); ii. Aspartate at position 239, glutamate at position 332 and
leucine at position 330 (DEL); iii. Aspartate at position 239, glutamate at position
332, alanine at position 236 (DEA); or iv. Aspartate at position 239, glutamate at
position 332, alanine at position 236 and leucine at position 330 (DEAL). In some
embodiments, provided is an anti-HIV gp120 V3 glycan antigen-binding fragment thereof,
as defined by the claims, for use in in a method of treating or preventing HIV, as
defined by the claims . In some embodiments, the antigen binding fragment is selected
from the group consisting of scFv, Fab, Fab2, Fab', F(ab')
2, Fv, and a diabody. In some embodiments, the antibody is one or more arms of a multi-specific
antibody,
e.g., a bispecific antibody. In some embodiments, the human subject is acutely infected
with HIV. In some embodiments, the antibody has been administered to a human subject
having an HIV infection of Fiebig stage IV or earlier,
e.g., Fiebig stage III, Fiebig stage II or Fiebig stage I. In some embodiments, the antibody
has been administered to a human subject who has not seroconverted. In some embodiments,
the human subject is recently infected with HIV,
e.g., within 1, 2, 3 or 4 weeks, or prior to detection, seroconversion or manifestation
of symptoms. In some embodiments, the antibody has been administered to a human subject
having an HIV infection of Fiebig stage V or Fiebig stage VI. In some embodiments,
the human subject is chronically infected with HIV. In some embodiments, the human
subject is infected with HIV clade B viruses.
[0014] In some embodiments of the claimed invention, the human subject may be infected with
HIV clade B viruses and the subject may be infected with an HIV or a population of
HIV expressing a gp120 comprising the following amino acid residues: i. N332glycan,
D325, L179, T320 and H330; or iii. N332glycan, D325, T63, L179, T320 and H330.
[0015] Disclosed but not within the literal scope of the claims, the human subject may be
infected with HIV clade B viruses and the subject may be infected with an HIV or a
population of HIV expressing a gp120 comprising the following amino acid residues
N332glycan, D325, T63 and H330.
[0016] In some embodiments of the claimed invention, the human subject is infected with
HIV clade A viruses. In some embodiments, the human subject is infected with HIV clade
C viruses. In some embodiments, one or more additional therapeutic agents for treating
an HIV infection are further administered to the subject. In some embodiments, the
subject is not receiving antiretroviral therapy (ART) or ART is discontinued prior
to administration of the antibody. In some embodiments, ART is discontinued after
one or more administrations of the antibody or antigen-binding fragment thereof. In
some embodiments, one or more antiretroviral therapy (ART) agents are further administered
to the subject. In some embodiments, a second antibody or antigen-binding fragment
thereof that binds to an epitope or region of gp120 selected from the group consisting
of: second variable loop (V2) and/or Env trimer apex; CD4 binding site (CD4bs); gp120/gp41
interface; or silent face of gp120 is further administered to the subject. In some
embodiments, the second antibody or antigen-binding fragment thereof binds to an epitope
or region of gp120 in the second variable loop (V2) and/or Env trimer apex and competes
with or comprises VH and VL regions from an antibody selected from the group consisting
of PG9, PG16, PGC14, PGG14, PGT-142, PGT-143, PGT-144, PGT-145, CH01, CH59, PGDM1400,
CAP256, CAP256-VRC26.08, CAP256-VRC26.09, CAP256-VRC26.25, PCT64-24E and VRC38.01.
In some embodiments, the second antibody or antigen-binding fragment thereof binds
to an epitope or region of gp120 in the CD4 binding site (CD4bs) and competes with
or comprises VH and VL regions from an antibody selected from the group consisting
of b12, F105, VRC01, VRC07, VRC07-523, VRC03, VRC06, VRC06b01 VRC08, VRC0801, NIH45-46,
GS-9723, GS-5423, 3BNC117, 3BNC60, VRC-PG04, PGV04; CH103, 44-VRC13.01, 1NC9, 12A12,
N6, N6LS (VRC-HIVMAB091-00-AB), N49-P7, NC-Cow1, IOMA, CH235 and CH235.12, N49P6,
N49P7, N49P11, N49P9 and N60P25. In some embodiments, the second antibody or antigen-binding
fragment thereof binds to an epitope or region of gp120 in the gp120/gp41 interface
and competes with or comprises VH and VL regions from an antibody selected from the
group consisting of PGT-151, CAP248-2B, 35022, 8ANC195, ACS202, VRC34 and VRC34.01.
In some embodiments, the second antibody or antigen-binding fragment thereof binds
to an epitope or region of the gp120 silent face and competes with or comprises VH
and VL regions from antibody VRC-PG05. In some embodiments, the second antibody or
antigen-binding fragment thereof binds to an epitope or region of gp41 in the membrane
proximal region (MPER) and competes with or comprises VH and VL regions from an antibody
selected from the group consisting of 10E8, 10E8v4, 10E8-5R-100cF, 4E10, DH511.11P,
2F5, 7b2, and LN01. In some embodiments, the second antibody or antigen-binding fragment
thereof binds to an epitope or region of the gp41 fusion peptide and competes with
or comprises VH and VL regions from an antibody selected from the group consisting
of VRC34 and ACS202. In some embodiments, a TLR agonist is further administered to
the subject. In some embodiments, the TLR agonist is a TLR2 agonist, a TLR3 agonist,
a TLR7 agonist, a TLR8 agonist or a TLR9 agonist. In some embodiments, the TLR7 agonist
is selected from the group consisting of vesatolimod, imiquimod, and resiquimod. In
some embodiments, multiple administrations of the antibody or antigen-binding fragment
thereof are administered to the subject, optionally with a TLR agonist, at predetermined
intervals. In some embodiments, after one or more administrations of the antibody
or antigen-binding fragment thereof, the subject does not exhibit symptoms of HIV
or AIDS in the absence of anti-retroviral treatment (ART) for at least 6 months, at
least 1 year, at least 2 years, at least 3 years, at least 4 years, at least 5 years
or longer. In some embodiments, after one or more administrations of the antibody,
the subject has an HIV viral load copies/ml blood of less than 500,
e.g., less than 400, less than 300, less than 200, less than 100, less than 50, in the
absence of anti-retroviral treatment (ART) for at least 6 months, at least 1 year,
at least 2 years, at least 3 years, or more.
[0017] In another aspect, provided are
in vitro methods of identifying a human subject infected with an HIV or a population of HIV
sensitive to an antibody or antigen-binding fragment thereof that comprises VH and
VL regions that bind to an epitope of gp120 within the third variable loop (V3) comprising
a N332 oligomannose glycan. In some embodiments, the methods comprise identifying
in a biological sample from the human subject a gp120 that has been determined via
polynucleotide or polypeptide sequencing to comprise the following amino acid residues:
a glycosylated asparagine at the position corresponding to amino acid residue position
332 (N332glycan), an aspartate at the position corresponding to amino acid residue
position 325 (D325), a leucine at the position corresponding to amino acid residue
position 179 (L179), and a histidine at the position corresponding to amino acid residue
position 330 (H330), and one or more amino acid residues selected from the group consisting
of: a threonine at the position corresponding to amino acid residue position 63 (T63),
and a threonine at the position corresponding to amino acid residue position 320 (T320),
wherein the amino acid positions are with reference to SEQ ID NO: 4 and wherein the
antibody or antigen-binding fragment thereof comprises a VH and a VL comprising the
amino acid sequences set forth, respectively, in:
| i. |
SEQ ID NOs.: 400 and 401; |
| ii. |
SEQ ID NOs.: 402 and 404; |
| iii. |
SEQ ID NOs.: 405 and 406. |
[0018] In the claimed invention, the method entails identifying a subject infected with
an HIV or a population of HIV expressing a gp120 comprising the following amino acid
residues: N332glycan, D325, L179 and H330, wherein the amino acid positions are with
reference to SEQ ID NO: 4.
[0019] In some embodiments of the claimed invention, the method entails identifying a subject
infected with an HIV or a population of HIV expressing a gp120 comprising the following
amino acid residues: i. N332glycan, D325, T63, L179 and H330, ii. N332glycan, D325,
L179, T320 and H330; or iii. N332glycan, D325, T63, L179, T320 and H330, wherein the
amino acid positions are with reference to SEQ ID NO: 4.
[0020] Disclosed but not within the literal scope of the claims, the method may entail identifying
a subject infected with an HIV or a population of HIV expressing a gp120 comprising
the following amino acid residues: i. N332glycan, D325 and T63; ii. N332glycan, D325
and L179; iii. N332glycan, D325 and T320; iv. N332glycan, D325 and H330; v. N332glycan,
D325, T63 and L179; vi. N332glycan, D325, T63 and T320; vii. N332glycan, D325, T63
and H330; viii. N332glycan, D325, L179 and T320; ix. N332glycan, D325, T320 and H330;
x. N332glycan, D325, T63, T320 and H330; or xi. N332glycan, D325, T63, L179 and T320;,
wherein the amino acid positions are with reference to SEQ ID NO: 4. Disclosed but
not within the literal scope of the claims, the method may entail identifying a subject
infected with an HIV or a population of HIV expressing a gp120 comprising the following
amino acid residues: i. N332glycan, D325 and T63; ii. N332glycan, D325 and L179; iii.
N332glycan, D325 and T320; or iv. N332glycan, D325 and H330, wherein the amino acid
positions are with reference to SEQ ID NO: 4. Disclosed but not within the literal
scope of the claims the method may entail identifying a subject infected with an HIV
or a population of HIV expressing a gp120 comprising the following amino acid residues:
i. N332glycan, D325, T63 and L179; ii. N332glycan, D325, T63 and T320; iii. N332glycan,
D325, T63 and H330; iv. N332glycan, D325, L179 and T320; v. N332glycan, D325, L179
and H330; or vi. N332glycan, D325, T320 and H330, wherein the amino acid positions
are with reference to SEQ ID NO: 4. Disclosed but not within the literal scope of
the claims, the method may entail identifying a subject infected with an HIV or a
population of HIV expressing a gp120 comprising the following amino acid residues:
i. N332glycan, D325, L179, T320 and H330; ii. N332glycan, D325, T63, T320 and H330;
iii. N332glycan, D325, T63, L179 and T320; or iv. N332glycan, D325, T63, L179 and
H330, wherein the amino acid positions are with reference to SEQ ID NO: 4. Disclosed
but not within the literal scope of the claims, the method may entail identifying
a subject infected with an HIV or a population of HIV expressing a gp120 comprising
the following amino acid residues: i. N332glycan, D325, T63 and H330; or ii. N332glycan,
D325, T320 and H330, wherein the amino acid positions are with reference to SEQ ID
NO: 4. In some embodiments, the subject is infected with an HIV or a population of
HIV expressing a gp120 further comprising one or more of the following amino acid
residues: a glycan at amino acid residue 301 (glycan301); a lysine at amino acid residue
677 (K677); an amino acid residue other than tryptophan (
e.g., A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V or Y) at position 17 (not_W17);
an amino acid residue other than arginine (
e.g., A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W or Y) at position 747 (not_R747);
an insertion_321.01 (
e.g., an insertion of any amino acid (
e.g., A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W or Y) between position
G321 and K322); a glutamic acid at position 429 (E429); a glutamine at position 442
(Q442); an arginine at position 335 (R335); an isoleucine at position 165 (I165);
a serine at position 393 (S393); an isoleucine at position 307 (I307); a glycan at
position 295 (295 glycan); and/or an asparagine at position 300 (N300), wherein the
amino acid positions are with reference to SEQ ID NO: 4.
[0021] In the claimed invention, the administered antibody or antigen-binding fragment thereof
comprises VH and VL regions from an antibody selected from the group consisting of
GS-9722, PGT-121 and 10-1074.
[0022] Disclosed but not within the literal scope of the claims, the antibody or antigen-binding
fragment thereof may compete with or comprise VH and VL regions from an antibody selected
from the group consisting of GS-9721, PGT-121.66, PGT-121.414, PGT-122, PGT-123, PGT-124,
PGT-125, PGT-126, PGT-128, PGT-130, PGT-133, PGT-134, PGT-135, PGT-136, PGT-137, PGT-138,
PGT-139, 10-1074-J, VRC24, 2G12, BG18, 354BG8, 354BG18, 354BG42, 354BG33, 354BG129,
354BG188, 354BG411, 354BG426, DH270.1, DH270.6, PGDM12, VRC41.01, PGDM21, PCDN-33A,
BF520.1 and VRC29.03. Disclosed but not within the literal scope of the claims, the
antibody or antigen-binding fragment thereof may compete with or comprise VH and VL
regions from an antibody selected from the group consisting of GS-9721, PGT-121.66,
PGT-121.414, PGT-124, PGT-134, GS-2872, 10-1074-J, PGT-122 and PGT-123. In some embodiments,
the human subject is acutely infected with HIV. In some embodiments, the antibody
has been administered to a human subject having an HIV infection of Fiebig stage IV
or earlier. In some embodiments, the antibody has been administered to a human subject
who has not seroconverted. In some embodiments, the human subject is recently infected
with HIV. In some embodiments, the antibody has been administered to a human subject
having an HIV infection of Fiebig stage V or Fiebig stage VI. In some embodiments,
the human subject is chronically infected with HIV. In some embodiments, the human
subject is infected with HIV clade B viruses. In some embodiments, the human subject
is infected with HIV clade B viruses and the methods entail identifying a subject
infected with an HIV or a population of HIV expressing a gp120 comprising the following
amino acid residues: i. N332glycan, D325, T63 and H330; ii. N332glycan, D325, L179,
T320 and H330; or iii. N332glycan, D325, T63, L179, T320 and H330. In some embodiments,
the human subject is infected with HIV clade A viruses. In some embodiments, the human
subject is infected with HIV clade C viruses.
[0023] With respect to further embodiments of the methods described herein, in some embodiments,
the gp120 amino acids are identified in one or more gp120 polypeptide sequences expressed
from an HIV or a population of HIV isolated from the subject. In some embodiments,
the gp120 amino acids are identified in one or more gp120 polynucleotide sequences
encoding a gp120 polypeptide from an HIV or a population of HIV isolated from the
subject. In various embodiments, the methods entail performing next generation sequencing
(NGS) on polynucleotide sequences encoding gp120 from a population of HIV. In some
embodiments, the gp120 variants are detected to a frequency level of about 1%,
e.g., to a frequency level of about 0.5%, of the virus population. In some embodiments,
the gp120 amino acids are identified in one or more biological samples from the subject,
wherein the one or more biological sample are obtained from blood, peripheral blood
mononuclear cells (PBMCs), serum, plasma, semen or lymph nodes. In some embodiments,
the methods entail identifying a population of HIV RNA in a serum or plasma sample.
In some embodiments, one or more biological samples have been obtained from the subject.
In some embodiments, two or more biological samples have been obtained from the subject.
In some embodiments, two or more biological samples have been obtained from the same
tissue or fluid at two or more different time points. In some embodiments, two or
more biological samples have been obtained from different tissues or fluids, or from
different anatomical locations.
DEFINITIONS
[0024] The words "a" and "an" denote one or more, unless specifically noted.
[0025] By "about" is meant a quantity, level, value, number, frequency, percentage, dimension,
size, amount, weight or length that varies by as much as 30, 25, 20, 15, 10, 9, 8,
7, 6, 5, 4, 3, 2 or 1% to a reference quantity, level, value, number, frequency, percentage,
dimension, size, amount, weight or length. In any embodiment discussed in the context
of a numerical value used in conjunction with the term "about," it is specifically
contemplated that the term about can be omitted.
[0026] Unless the context requires otherwise, throughout the present specification and claims,
the word "comprise" and variations thereof, such as, "comprises" and "comprising"
are to be construed in an open, inclusive sense, that is as "including, but not limited
to". Where the terms "comprise" or "comprising" are used herein, it is understood
that the disclosure further includes embodiments wherein these terms are replaced
with "consist of" or "consist essentially of" or "consisting of" or "consisting essentially
of."
[0027] By "consisting of" is meant including, and limited to, whatever follows the phrase
"consisting of." Thus, the phrase "consisting of" indicates that the listed elements
are required or mandatory, and that no other elements may be present.
[0028] By "consisting essentially of" is meant including any elements listed after the phrase,
and limited to other elements that do not interfere with or contribute to the activity
or action specified in the disclosure for the listed elements. Thus, the phrase "consisting
essentially of" indicates that the listed elements are required or mandatory, but
that other elements are optional and may or may not be present depending upon whether
or not they affect the activity or action of the listed elements.
[0029] Reference throughout this specification to "one embodiment" or "an embodiment" means
that a particular feature, structure or characteristic described in connection with
the embodiment is included in at least one embodiment described herein. Thus, the
appearances of the phrases "in one embodiment" or "in an embodiment" in various places
throughout this specification are not necessarily all referring to the same embodiment..
[0030] An "increased" or "enhanced" amount is typically a "statistically significant" amount,
and may include an increase that is 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2,
2.5, 3, 3.5, 4, 4.5, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, or 50 or more times (
e.g., 100, 500, 1000 times) (including all integers and decimal points in between and
above 1,
e.g., 2.1, 2.2, 2.3, 2.4, etc.) an amount or level described herein. It may also include
an increase of at least 10%, at least 20%, at least 30%, at least 40%, at least 50%,
at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 150%,
at least 200%, at least 500%, or at least 1000% of an amount or level described herein.
[0031] A "decreased" or "reduced" or "lesser" amount is typically a "statistically significant"
amount, and may include a decrease that is about 1.1, 1.2, 1.3, 1.4, 1.5, 1.6 1.7,
1.8, 1.9, 2, 2.5, 3, 3.5, 4, 4.5, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, or 50 or more
times (
e.g., 100, 500, 1000 times) (including all integers and decimal points in between and
above 1,
e.g., 1.5, 1.6, 1.7. 1.8, etc.) an amount or level described herein. It may also include
a decrease of at least 10%, at least 20%, at least 30%, at least 40%, at least 50%,
at least 60%, at least 70%, at least 80%, or at least 90%, at least 100%, at least
150%, at least 200%, at least 500%, or at least 1000% of an amount or level described
herein.
[0032] A "composition" can comprise an active agent,
e.g., a contrast agent and a carrier, inert or active,
e.g., a pharmaceutically acceptable carrier, diluent or excipient. A composition may
be a pharmaceutical composition. The compositions are sterile, substantially free
of endotoxins or non-toxic to recipients at the dosage or concentration employed.
[0033] "Pharmaceutically acceptable carrier, diluent or excipient" includes without limitation
any adjuvant, carrier, excipient, glidant, sweetening agent, diluent, preservative,
dye/colorant, flavor enhancer, surfactant, wetting agent, dispersing agent, suspending
agent, stabilizer, isotonic agent, solvent or emulsifier which has been approved by
the United States Food and Drug Administration as being acceptable for use in humans
or domestic animals.
[0034] A "biological sample" or "sample" refers to any fluid, cellular or solid tissue sample
from a subject that has or is suspected of having detectable HIV.
[0035] A "subject," "individual" or "patient" refers to any mammal, including humans and
non-human primates. The mammal is human.
[0036] The term "buffer" as used herein denotes a pharmaceutically acceptable excipient,
which stabilizes the pH of a pharmaceutical preparation. Suitable buffers are well
known in the art. Suitable pharmaceutically acceptable buffers include but are not
limited to acetate-buffers, histidine-buffers, citrate-buffers, succinate-buffers,
tris-buffers and phosphate-buffers. The concentration of the buffer may be from about
0.01mM to about 1000 mM, about 0.1mM to about 1000 mM, about 0.1mM to about 500 mM,
about 0.1 to about 200 mM, about 0.1 to about 100 mM, about 1 mM to about 1000 mM,
about 1 mM to about 500 mM, about 1 mM to about 200 mM, about 1 mM to about 100 mM,
about 1 mM to about 50 mM, about 2 mM to about 60 mM, about 4 mM to about 60 mM, or
about 4 mM to about 40 mM, about 5 mM to about 20 mM, or about 5 mM to about 25 mM.
[0037] "Optional" or "optionally" means that the subsequently described event of circumstances
may or may not occur, and that the description includes instances where said event
or circumstance occurs and instances in which it does not.
[0038] "Pharmaceutical composition" refers to a formulation of a compound and a medium generally
accepted in the art for the delivery of the biologically active compound to mammals,
e.g., humans. Such a medium may include any pharmaceutically acceptable carriers, diluents
or excipients therefore.
[0039] "Effective amount" or "therapeutically effective amount" refers to that amount of
an antibody or antigen-binding fragment thereof that, when administered alone or in
combination with another therapeutic agent to a cell, tissue, or subject is sufficient
to effect treatment or a beneficial result in the subject. The amount which constitutes
an "effective amount" will vary depending on the antibody or antigen-binding fragment
thereof and its specific use, and potentially also the condition and its severity,
the manner of administration, and the age of the subject to be treated, but can be
determined routinely by one of ordinary skill in the art having regard to his own
knowledge and to this disclosure. A therapeutically effective dose further refers
to that amount of the antibody or antigen-binding fragment thereof sufficient to treat,
prevent or ameliorate an infection or disease condition or the progression of an infection
or disease, and that amount sufficient to effect an increase in rate of treatment,
healing, prevention or amelioration of such conditions. When applied to an individual
antibody or antigen-binding fragment thereof administered alone, a therapeutically
effective dose refers to that active ingredient alone. When applied to a combination,
a therapeutically effective dose refers to combined amounts of the active ingredients
that result in the therapeutic effect, whether administered in combination, serially
or simultaneously.
[0040] "Treat," "treating" or "treatment" as used herein covers the treatment of the disease,
injury, or condition of interest,
e.g., HIV-1 infection, in a subject,
e.g., a mammal, such as a human, having the disease or condition of interest, and includes:
(i) inhibiting progression of the disease, injury, or condition, i.e., arresting its
development; (ii) reducing or relieving the disease, injury, or condition, i.e., causing
regression of the disease or condition; or (iii) relieving the symptoms resulting
from the disease, injury, or condition. As used herein, the terms "disease," "disorder,"
and "condition" may be used interchangeably. As used herein, "inhibition," "treatment,"
"treating," and "ameliorating" are used interchangeably and refer to,
e.g., stasis of symptoms, prolongation of survival, partial or full amelioration of symptoms,
and partial or full eradication of a condition, disease or disorder.
[0041] As used herein, "prevent" or "prevention" includes (i) preventing or inhibiting the
disease, injury, or condition from occurring in a subject, in particular, when such
subject is predisposed to the condition but has not yet been diagnosed as having it;
or (ii) reducing the likelihood that the disease, injury, or condition will occur
in the subject.
[0042] As used herein, the term "antibody" means an isolated or recombinant binding agent
that comprises the necessary variable region sequences to specifically bind an antigenic
epitope. Therefore, an antibody is any form of antibody or fragment thereof that exhibits
the desired biological activity,
e.g., binding the specific target antigen. Thus, it is used in the broadest sense and
specifically covers monoclonal antibodies (including full-length monoclonal antibodies),
polyclonal antibodies, human antibodies, humanized antibodies, chimeric antibodies,
nanobodies, diabodies, multispecific antibodies (
e.g., bispecific antibodies), and antibody fragments including but not limited to scFv,
Fab, and Fab2, so long as they exhibit the desired biological activity.
[0043] The term "human antibody" refers to antibodies containing sequences of human origin,
except for possible non-human CDR regions, and does not imply that the full structure
of an Ig molecule be present, only that the antibody has minimal immunogenic effect
in a human.
[0044] "Antibody fragments" comprise a portion of an intact antibody, for example, the antigen-binding
or variable region of the intact antibody. Examples of antibody fragments include
Fab, Fab', F(ab ')2, and Fv fragments; diabodies; linear antibodies (
e.g.,
Zapata et al., Protein Eng. 8(10): 1057-1062 (1995)); single-chain antibody molecules (
e.g., scFv); and multispecific antibodies formed from antibody fragments. Papain digestion
of antibodies produces two identical antigen-binding fragments, called "Fab" fragments,
each with a single antigen-binding site, and a residual "Fc" fragment, a designation
reflecting the ability to crystallize readily. Pepsin treatment yields an F(ab ')2
fragment that has two antigen combining sites and is still capable of cross-linking
antigen.
[0045] "Fv" is the minimum antibody fragment which contains a complete antigen-recognition
and -binding site. This region consists of a dimer of one heavy- and one light-chain
variable domain in tight, non-covalent association. It is in this configuration that
the three CDRS of each variable domain typically interact to define an antigen-binding
site on the surface of the VH-VL dimer. Generally, the six CDRs collectively confer
antigen-binding specificity to the antibody, although there are examples of antigen-binding
specificity being maintained when one or more of the six CDRs are deleted or modified,
e.g., by altering the amino acid sequence of the one or more CDRs,
e.g., by amino acid insertion, deletion or substitution. In addition, even a single variable
domain (or half of an Fv comprising only three CDRs specific for an antigen) has the
ability to recognize and bind antigen, although at a lower affinity than the entire
binding site. Residues other than those present in the CDRs may also be important
for or play a role in antigen binding and/or specificity as shown for PGT121 and closely
related somatic variants which interact with the gp120 antigen using residues in light
chain framework 3 (
Julien et al. Science 342:1477-83 (2013);
Julien et al. PLOS Pathog. 9: e1003342 (2013)) These residues in part arise from an unusual three amino acid insertion which extends
an otherwise short surface loop in PGT121 and related somatic variants (
e.g. PGT122, PGT123, PGT124, PGT133, PGT134, 10-1074) that contacts both the N332 linked
glycan and protein residues on HIV Env, effectively forming an additional (
e.g. a fourth) complementarity determining region (CDR) loop in the PGT121 light chain
between LC CDRs 2 and 3.
[0046] The term "hypervariable region" refers to the amino acid residues of an antibody
that are typically responsible for antigen-binding. The hypervariable region generally
comprises amino acid residues from a "complementarity determining region" or "CDR"
(
e.g., around about residues 24-34 (L1), 50-56 (L2) and 89-97 (L3) in the VL, and around
about 31-35 (H1), 50-65 (H2) and 95-102 (H3) in the VH when numbered in accordance
with the Kabat numbering system;
Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health
Service, National Institutes of Health, Bethesda, Md. (1991)); and/or those residues from a "hypervariable loop" (
e.g., residues 24-34 (L1), 50-56 (L2) and 89-97 (L3) in the VL, and 26-32 (H1), 52-56
(H2) and 95-101 (H3) in the VH when numbered in accordance with the Chothia numbering
system;
Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)); and/or those residues from a "hypervariable loop" VCDR (e.g., residues 27-38 (L1),
56-65 (L2) and 105-120 (L3) in the VL, and 27-38 (H1), 56-65 (H2) and 105-120 (H3)
in the VH when numbered in accordance with the IMGT numbering system;
Lefranc, M.P. et al. Nucl. Acids Res. 27:209-212 (1999),
Ruiz, M. e al. Nucl. Acids Res. 28:219-221 (2000)). Optionally, the antibody has symmetrical insertions at one or more of the following
points 28, 36 (L1), 63, 74-75 (L2) and 123 (L3) in the VL, and 28, 36 (H1), 63, 74-75
(H2) and 123 (H3) in the VH when numbered in accordance with AHo;
Honneger, A. and Plunkthun, A. J. Mol. Biol. 309:657-670 (2001)).
[0047] The "Fab" fragment is a region on an antibody that binds to antigens. It is composed
of one constant and one variable domain of each of the heavy and light chain. These
domains shape the paratope - the antigen-binding site - at the amino terminal end
of the monomer. The two variable domains bind the epitope on their specific antigens.
Fab fragments differ from Fab ' fragments by the addition of a few residues at the
carboxy terminus of the heavy chain CH1 domain including one or more cysteines from
the antibody hinge region. Fab'-SH is the designation herein for Fab' in which the
cysteine residue(s) of the constant domains bear a free thiol group. F(ab ')2 antibody
fragments originally were produced as pairs of Fab' fragments which have hinge cysteines
between them. Other chemical couplings of antibody fragments are also known.
[0048] The "light chains" of antibodies (immunoglobulins) from any vertebrate species can
be assigned to one of two clearly distinct types, called kappa and lambda, based on
the amino acid sequences of their variable or constant domains. Depending on the amino
acid sequence of the constant domain of their heavy chains, immunoglobulins can be
assigned to different classes. There are five major classes of immunoglobulins: IgA,
IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses
(isotypes),
e.g., IgG1, IgG2, IgG3, IgG4, IgA, and IgA2.
[0049] "Single-chain Fv" or "scFv" or "sFv" antibody fragments comprise the VH and VL domains
of antibody, wherein these domains are present in a single polypeptide chain. In some
embodiments, the Fv polypeptide further comprises a polypeptide linker between the
VH and VL domains, which enables the sFv to form the desired structure for antigen-binding.
[0050] The term "diabodies" refers to small antibody fragments with two antigen-binding
sites, which fragments comprise a heavy-chain variable domain (VH) connected to a
light-chain variable domain (VL) in the same polypeptide chain (VH-VL). By using a
linker that is too short to allow pairing between the two domains on the same chain,
the domains are forced to pair with the complementary domains of another chain and
create two antigen-binding sites. Diabodies are described more fully in, for example,
EP 404,097;
WO 93/11161; and
Hollinger et al, Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993).
[0051] An "isolated" antibody or antigen-binding fragment thereof is one that has been identified
and separated and/or recovered from a component of its natural environment. Contaminant
components of its natural environment are materials that would interfere with diagnostic
or therapeutic uses for the antibody, and may include enzymes, hormones, and other
proteinaceous or nonproteinaceous solutes. In some embodiments, the antibody will
be purified (1) to greater than 95% by weight of antibody as determined by the Lowry
method, for example, more than 99% by weight, (2) to a degree sufficient to obtain
at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning
cup sequenator, or (3) to homogeneity by SDS-PAGE under reducing or nonreducing conditions
using Coomassie blue or silver stain. Isolated antibody includes the antibody in situ
within recombinant cells since at least one component of the antibody's natural environment
will not be present. Ordinarily, however, isolated antibody will be prepared by at
least one purification step.
[0052] An antibody or antigen-binding fragment thereof that "specifically binds to" or is
"specific for" a particular polypeptide or an epitope on a particular polypeptide
is one that binds to that particular polypeptide or epitope on a particular polypeptide
without substantially binding to any other polypeptide or polypeptide epitope. In
some embodiments, the antibody of the present disclosure specifically binds to an
antigen, e.g., an HIV-1 gp120 polypeptide, with dissociation constant Kd equal to
or lower than 100 nM, optionally lower than 10 nM, optionally lower than 1 nM, optionally
lower than 0.5 nM, optionally lower than 0.1 nM, optionally lower than 0.01 nM, or
optionally lower than 0.005 nM, in the form of monoclonal antibody, scFv, Fab, or
other form of antibody measured at a temperature of about 4° C., 25° C., 37° C., or
42° C. Affinities of antibodies can be readily determined using conventional techniques,
for example, those described by
Scatchard et al. (Ann. N. Y. Acad. Sci. USA 51: 660 (1949), ELISA assays, biolayer interferometry (BLI) assays, and surface plasmon resonance
(SPR) assays). Binding properties of an antibody to antigens, cells or tissues thereof
may generally be determined and assessed using immunodetection methods including,
for example, immunofluorescence-based assays, such as immuno-histochemistry (IHC)
and/or fluorescence- activated cell sorting (FACS).
[0053] As used herein, an antibody that "internalizes" is one that is taken up by (
i.e., enters) the cell upon binding to an antigen on a mammalian cell {
e.g., a cell surface polypeptide or receptor). The internalizing antibody will of course
include antibody fragments, human or chimeric antibody, and antibody conjugates. For
certain therapeutic applications, internalization in vivo is contemplated. The number
of antibody molecules internalized will be sufficient or adequate to kill a cell or
inhibit its growth, especially an infected cell. Depending on the potency of the antibody
or antibody conjugate, in some instances, the uptake of a single antibody molecule
into the cell is sufficient to kill the target cell to which the antibody binds. For
example, certain toxins are highly potent in killing such that internalization of
one molecule of the toxin conjugated to the antibody is sufficient to kill the infected
cell.
[0054] The term "antagonist" antibody is used in the broadest sense, and includes an antibody
that partially or fully blocks, inhibits, or neutralizes a biological activity of
an epitope, polypeptide, or cell that it specifically binds. Methods for identifying
antagonist antibodies may comprise contacting a polypeptide or cell specifically bound
by a candidate antagonist antibody with the candidate antagonist antibody and measuring
a detectable change in one or more biological activities normally associated with
the polypeptide or cell.
[0055] An "antibody that inhibits the growth of infected cells" or a "growth inhibitory"
antibody is one that binds to and results in measurable growth inhibition of infected
cells expressing or capable of expressing an HIV1 epitope bound by an antibody. Preferred
growth inhibitory antibodies inhibit growth of infected cells by greater than 20%,
preferably from about 20% to about 50%, and even more preferably, by greater than
50% (
e.g., from about 50% to about 100%) as compared to the appropriate control, the control
typically being infected cells not treated with the antibody being tested. Growth
inhibition can be measured at an antibody concentration of about 0.1 to about 30 µg/ml
or about 0.5 nM to about 200 nM in cell culture, where the growth inhibition is determined
1-10 days after exposure of the infected cells to the antibody. Growth inhibition
of infected cells in vivo can be determined in various ways known in the art. The
antibody is growth inhibitory in vivo if administration of the antibody at about 1
µg/kg to about 100 mg/kg body weight results in reduction the percent of infected
cells or total number of infected cells within about 5 days to 3 months from the first
administration of the antibody, preferably within about 5 to 30 days.
[0056] An antibody that "induces apoptosis" is one which induces programmed cell death as
determined by binding of annexin V, fragmentation of DNA, cell shrinkage, dilation
of endoplasmic reticulum, cell fragmentation, and/or formation of membrane vesicles
(called apoptotic bodies). Preferably the cell is an infected cell. Various methods
are available for evaluating the cellular events associated with apoptosis. For example,
phosphatidyl serine (PS) translocation can be measured by annexin binding; DNA fragmentation
can be evaluated through DNA laddering; and nuclear/chromatin condensation along with
DNA fragmentation can be evaluated by any increase in hypodiploid cells. Preferably,
the antibody that induces apoptosis is one that results in about 2- to 50-fold, preferably
about 5- to 50-fold, and most preferably about 10- to 50-fold, induction of annexin
binding relative to untreated cell in an annexin binding assay.
[0057] Antibody "effector functions" refer to those biological activities attributable to
the Fc region (a native sequence Fc region or amino acid sequence variant Fc region)
of an antibody, and vary with the antibody isotype. Examples of antibody effector
functions include: Clq binding and complement dependent cytotoxicity; Fc receptor
binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis (
e.g., antibody-dependent cell-mediated phagocytosis (ADCP)); down regulation of cell
surface receptors (
e.g., B cell receptor); and B cell activation.
[0058] "Antibody-dependent cell-mediated cytotoxicity" or "ADCC" refers to a form of cytotoxicity
in which secreted or exogenously administered Ig bound to Fc receptors (FcRs) present
on certain cytotoxic cells (
e.g., Natural Killer (NK) cells, neutrophils, and macrophages) enable these cytotoxic
effector cells to bind specifically to an antigen-bearing target cell and subsequently
kill the target cell with cytotoxins. The antibodies "arm" the cytotoxic cells and
are required for such killing. The primary cells for mediating ACC, NK cells, express
FcγRIII only, whereas monocytes express FcγRI, FcγRII and FcγRIII. FcR expression
on hematopoietic cells is summarized in Table 4 on page 464 of
Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991). To assess ADCC activity of a molecule of interest, an in vitro ADCC assay, such
as that described in
U.S. Pat. No. 5,500,362 or
U.S. Pat. No. 5,821,337 may be performed. Useful effector cells for such assays include peripheral blood
mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally,
ADCC activity of the antibody or antigen-binding fragment thereof may be assessed
in vivo,
e.g., in an animal model such as that disclosed in
Clynes et al., Proc. Natl. Acad. Sci. (USA) 95:652-656 (1998).
[0059] "Fc receptor" or "FcR" describes a receptor that binds to the Fc region of an antibody.
In certain embodiments, the FcR is a native sequence human FcR. Moreover, a preferred
FcR is one that binds an IgG antibody (a gamma receptor) and includes receptors of
the FcγRI, FcγRII, and FcγRIII subclasses, including allelic variants and alternatively
spliced forms of these receptors. FcγRII receptors include FcγRIIA (an "activating
receptor") and FcγRIIB (an "inhibiting receptor"), which have similar amino acid sequences
that differ primarily in the cytoplasmic domains thereof, and FcγRIIC, which includes
the FcγRIIB extracellular domain fused to an activating cytoplasmic region. Activating
receptor FcγRIIA contains an immunoreceptor tyrosine- based activation motif (ITAM)
in its cytoplasmic domain. Inhibiting receptor FcγRIIB contains an immunoreceptor
tyrosine-based inhibition motif (ITIM) in its cytoplasmic domain (see review
M. in Daeron, Annu. Rev. Immunol. 15:203-234 (1997)). FcRs are reviewed in
Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991);
Capel et al, Immunomethods 4:25-34 (1994); and
de Haas et al, J. Lab. Clin. Med. 126:330-41 (1995). Other FcRs, including those to be identified in the future, are encompassed by
the term "FcR" herein. The term also includes the neonatal receptor, FcRn, which is
responsible for the transfer of maternal IgGs to the fetus (
Guyer et al, J. Immunol. 117:587 (1976) and
Kim et al, J. Immunol. 24:249 (1994)), and which plays a role in salvaging IgG from lysosomal degradation by FcRn dependent
recycling following endocytosis. FcRn binding following pinocytosis in endothelial
cells has been shown to be important for sustaining the prolonged pharmacokinetic
half-life of antibodies. Assessment of pH dependent human FcRn binding of antibodies
in vitro may be performed to provide a prediction of potential for favorable clinical
pharmacokinetics (
Datta-Mannan and Wroblewski, Drug Metab. Dispos. 42:1867-1872 (2014)).
[0060] "Human effector cells" are leukocytes that express one or more FcRs and perform effector
functions. Preferably, the cells express at least FcγRIII and perform ADCC effector
function. Examples of human leukocytes that mediate ADCC include PBMC, NK cells, monocytes,
cytotoxic T cells and neutrophils; with PBMCs and NK cells being preferred. The effector
cells may be isolated from a native source,
e.g., from blood.
[0061] "Complement dependent cytotoxicity" or "CDC" refers to the lysis of a target cell
in the presence of complement. Activation of the classical complement pathway is initiated
by the binding of the first component of the complement system (Clq) to antibodies
(of the appropriate subclass) that are bound to their cognate antigen. To assess complement
activation, a CDC assay,
e.g., as described in
Gazzano-Santoro et al, J. Immunol. Methods 202: 163 (1996), may be performed.
[0062] A "neutralizing antibody" is one that can neutralize the ability of that pathogen
to initiate and/or perpetuate an infection in a host and/or in target cells in vitro.
Described herein are neutralizing monoclonal human antibodies and antigen-binding
fragments thereof, wherein the antibody recognizes an antigen from HIV,
e.g., a gp120 polypeptide. In certain embodiments, a "neutralizing antibody" may inhibit
the entry of HIV-1 virus,
e.g., SF162 and/or JR-CSF, with a neutralization index >1.5 or >2.0 (
Kostrikis LG et al. / Virol. 1996; 70(1): 445-458). By "broadly neutralizing antibodies" are meant antibodies that neutralize more
than one HIV-1 virus species (from diverse clades and different strains within a clade)
in a neutralization assay. A broad neutralizing antibody may neutralize at least 2,
3, 4, 5, 6, 7, 8, 9 or more different strains of HIV-1, the strains belonging to the
same or different clades. In particular embodiments, a broad neutralizing antibody
may neutralize multiple HIV-1 species belonging to at least 2, 3, 4, 5, or 6 different
clades. In certain embodiments, the inhibitory concentration of the monoclonal antibody
may be less than about 0.0001 µg/ml, less than about 0.001 µg/ml, less than about
0.01 µg/ml, less than about 0.1 µg/ml, less than about 0.5 µg/ml, less than about
1.0 µg/ml, less than about 5 µg/ml, less than about 10 µg/ml, less than about 25 µg/ml,
less than about 50 µg/ml, or less than about 100 µg/ml to neutralize about 50% of
the input virus in the neutralization assay.
[0063] HIV viruses are divided into specific groups, M, N, O and P, of which M is the "major"
group and responsible for majority of HIV/AIDS globally. Based on their genetic sequence,
Group M is further subdivided into subtypes (also called clades) with prevalence in
distinct geographical locations.
[0064] A Group M "subtype" or "clade" is a subtype of HIV-1 group M defined by genetic sequence
data. Examples of Group M subtypes include Subtypes A-K. Some of the subtypes are
known to be more virulent or are resistant to different medications. There are also
"circulating recombinant forms" or CRFs derived from recombination between viruses
of different subtypes, which are each given a number. CRF12_BF, for example, is a
recombination between subtypes B and F. Subtype A is common in West Africa. Subtype
B is the dominant form in Europe, the Americas, Japan, Thailand, and Australia. Subtype
C is the dominant form in Southern Africa, Eastern Africa, India, Nepal, and parts
of China. Subtype D is generally only seen in Eastern and central Africa. Subtype
E has never been identified as a nonrecombinant, only recombined with subtype A as
CRF01_AE. Subtype F has been found in central Africa, South America and Eastern Europe.
Subtype G (and the CRF02_AG) have been found in Africa and central Europe. Subtype
H is limited to central Africa. Subtype I was originally used to describe a strain
that is now accounted for as CRF04_cpx, with the cpx for a "complex" recombination
of several subtypes. Subtype J is primarily found in North, Central and West Africa,
and the Caribbean Subtype K is limited to the Democratic Republic of Congo and Cameroon.
These subtypes are sometimes further split into sub-subtypes such as A1 and A2 or
F1 and F2. In 2015, the strain CRF19, a recombinant of subtype A, subtype D and subtype
G, with a subtype D protease was found to be strongly associated with rapid progression
to AIDS in Cuba.
[0065] "HIV tropism" refers to the specificity of an HIV virus for a particular host cell,
determined in part by the interaction of viral surface structures with receptors present
on the surface of the host cell. HIV tropism of a patient's virus may be measured,
e.g. by sequencing analysis or by the TROFILE
® assay (monogrambio.com) (
see,
e.g.,
Lee, et al, AIDS Res Hum Retroviruses. (2013) 29(6):979-84).
[0066] HIV can infect a variety of cells such as CD4+ helper T cells and macrophages that
express the CD4 molecule on their surface. HIV-1 entry to macrophages and T helper
cells is mediated not only through interaction of the virion envelope glycoprotein,
(
e.g., gp120) with the CD4 molecule on the target cells but also with its chemokine coreceptors.
Macrophage (M-tropic) strains of HIV-1, or non-syncitia-inducing strains (NSI) use
the beta-chemokine receptor CCR5 for entry and are thus able to replicate in macrophages
and CD4+ T-cells. These strains are called R5 viruses. This CCR5 coreceptor is used
by almost all primary HIV-1 isolates regardless of viral genetic subtype. T-tropic
isolates, or syncitia-inducing (SI) strains replicate in primary CD4+ T-cells as well
as in macrophages and use the alpha-chemokine receptor, CSCR4, for entry. These strains
are called X4 viruses. Viruses that use only the CCR5 receptor are termed R5, those
that only use CXCR4 are termed X4, and those that use both, X4R5 or dual/mixed-tropism.
However, the use of a coreceptor alone does not explain viral tropism, as not all
R5 viruses are able to use CCR5 on macrophages for a productive infection.
[0067] Also described herein are "non-neutralizing antibodies," which are antibodies that
bind to one or more strains of virus but do not neutralize the virus. However, in
terms of Fc-mediated killing, the non-neutralizing antibody could still eliminate
cells expressing viral antigens that are bound but not neutralized by the antibody.
Thus, an antibody can bind a viral antigen and eliminate virally infected cells without
neutralizing the virus.
[0068] The term "nucleic acid molecule" refers to a polymeric form of nucleotides and includes
both sense and anti-sense strands of RNA, cDNA, genomic DNA, and synthetic forms and
mixed polymers of the above. A nucleotide refers to a ribonucleotide, deoxynucleotide
or a modified form of either type of nucleotide, and combinations thereof. The terms
also include, but is not limited to, single- and double-stranded forms of DNA. In
addition, a polynucleotide,
e.g., a cDNA or mRNA, may include either or both naturally occurring and modified nucleotides
linked together by naturally occurring and/or non-naturally occurring nucleotide linkages.
The nucleic acid molecules may be modified chemically or biochemically or may contain
non-natural or derivatized nucleotide bases, as will be readily appreciated by those
of skill in the art. Such modifications include, for example, labels, methylation,
substitution of one or more of the naturally occurring nucleotides with an analogue,
internucleotide modifications such as uncharged linkages (
e.g., methyl phosphonates, phosphotriesters, phosphoramidates, carbamates, etc.), charged
linkages (
e.g., phosphorothioates, phosphorodithioates, etc.), pendent moieties (
e.g., polypeptides), intercalators (
e.g., acridine, psoralen, etc.), chelators, alkylators, and modified linkages (
e.g., alpha anomeric nucleic acids, etc.). The above term is also intended to include
any topological conformation, including single-stranded, double-stranded, partially
duplexed, triplex, hairpinned, circular and padlocked conformations. A reference to
a nucleic acid sequence encompasses its complement unless otherwise specified. Thus,
a reference to a nucleic acid molecule having a particular sequence should be understood
to encompass its complementary strand, with its complementary sequence. The term also
includes codon-optimized nucleic acids.
[0069] The term "operably linked" refers to two or more nucleic acid sequence elements that
are usually physically linked and are in a functional relationship with each other.
For instance, a promoter is operably linked to a coding sequence if the promoter is
able to initiate or regulate the transcription or expression of a coding sequence,
in which case, the coding sequence should be understood as being "under the control
of" the promoter.
[0070] A "substitution," as used herein, denotes the replacement of one or more amino acids
or nucleotides by different amino acids or nucleotides, respectively.
[0071] An "isolated" nucleic acid refers to a nucleic acid molecule that has been separated
from a component of its natural environment. An isolated nucleic acid includes a nucleic
acid molecule contained in cells that ordinarily contain the nucleic acid molecule,
but the nucleic acid molecule is present extrachromosomally or at a chromosomal location
that is different from its natural chromosomal location.
[0072] "Isolated nucleic acid encoding an antibody or fragment thereof" refers to one or
more nucleic acid molecules encoding antibody heavy and light chains (or fragments
thereof), including such nucleic acid molecule(s) in a single vector or separate vectors,
and such nucleic acid molecule(s) present at one or more locations in a host cell.
[0073] The term "vector," as used herein, refers to a nucleic acid molecule capable of propagating
another nucleic acid to which it is linked. The term includes the vector as a self-replicating
nucleic acid structure as well as the vector incorporated into the genome of a host
cell into which it has been introduced. Certain vectors are capable of directing the
expression of nucleic acids to which they are operatively linked. Such vectors are
referred to
[0074] A polynucleotide "variant," as the term is used herein, is a polynucleotide that
typically differs from a polynucleotide specifically disclosed herein in one or more
substitutions, deletions, additions and/or insertions. Such variants may be naturally
occurring or may be synthetically generated, for example, by modifying one or more
of the polynucleotide sequences described herein and evaluating one or more biological
activities of the encoded polypeptide as described herein and/or using any of a number
of techniques well known in the art.
[0075] A polypeptide "variant," as the term is used herein, is a polypeptide that typically
differs from a polypeptide specifically disclosed herein in one or more substitutions,
deletions, additions and/or insertions. Such variants may be naturally occurring or
may be synthetically generated, for example, by modifying one or more of the above
polypeptide sequences of the invention and evaluating one or more biological activities
of the polypeptide as described herein and/or using any of a number of techniques
well known in the art.
[0076] The term "variant" may also refer to any naturally occurring or engineered molecule
comprising one or more nucleotide or amino acid mutations. The molecule is an antibody.
For example, somatic variants may encompass all related naturally occurring antibodies
that are part of or derived from the same B-cell lineage. Engineered variants may
encompass all single mutations or combinatorial mutations made to an antibody.
[0077] Modifications may be made in the structure of the polynucleotides and polypeptides
disclosed but not within the literal scope of the claims and still obtain a functional
molecule that encodes a variant or derivative polypeptide with desirable characteristics.
When it is desired to alter the amino acid sequence of a polypeptide to create an
equivalent, or even an improved, variant or portion of a polypeptide of the invention,
one skilled in the art will typically change one or more of the codons of the encoding
DNA sequence.
[0078] For example, certain amino acids may be substituted for other amino acids in a protein
structure without appreciable loss of its ability to bind other polypeptides (
e.g., antigens) or cells. Since it is the binding capacity and nature of a protein that
defines that protein's biological functional activity, certain amino acid sequence
substitutions can be made in a protein sequence, and, of course, its underlying DNA
coding sequence, and nevertheless obtain a protein with like properties. It is thus
contemplated that various changes may be made in the polypeptide sequences of the
disclosed antibodies and antigen-binding fragments thereof, or corresponding DNA sequences
that encode said polypeptides without appreciable loss of their biological utility
or activity.
[0079] In many instances, a polypeptide variant will contain one or more conservative substitutions.
A "conservative substitution" is one in which an amino acid is substituted for another
amino acid that has similar properties, such that one skilled in the art of peptide
chemistry would expect the secondary structure and hydropathic nature of the polypeptide
to be substantially unchanged.
[0080] When comparing polynucleotide and polypeptide sequences, two sequences are said to
be "identical" if the sequence of nucleotides or amino acids in the two sequences
is the same when aligned for maximum correspondence, as described below. Comparisons
between two sequences are typically performed by comparing the sequences over a comparison
window to identify and compare local regions of sequence similarity. A "comparison
window" as used herein, refers to a segment of at least about 20 contiguous positions,
usually 30 to about 75, 40 to about 50, in which a sequence may be compared to a reference
sequence of the same number of contiguous positions after the two sequences are optimally
aligned.
[0081] Alignment of sequences for comparison may be conducted using the Megalign program
in the Lasergene suite of bioinformatics software (DNASTAR, Inc., Madison, WI), using
default parameters. This program embodies several alignment schemes described in the
following references:
Dayhoff, M.O. (1978) A model of evolutionary change in proteins - Matrices for detecting
distant relationships. In Dayhoff, M.O. (ed.) Atlas of Protein Sequence and Structure,
National Biomedical Research Foundation, Washington DC Vol. 5, Suppl. 3, pp. 345-358;
Hein J. (1990) Unified Approach to Alignment and Phylogenes pp. 626-645 Methods in
Enzymology vol. 183, Academic Press, Inc., San Diego, CA;
Higgins, D.G. and Sharp, P.M. (1989) CABIOS 5: 151-153;
Myers, E.W. and Muller W. (1988) CABIOS 4:11-17;
Robinson, E.D. (1971) Comb. Theor 77: 105;
Santou, N. Nes, M. (1987) Mol. Biol. Evol. 4:406-425;
Sneath, P.H.A. and Sokal, R.R. (1973) Numerical Taxonomy - the Principles and Practice
of Numerical Taxonomy, Freeman Press, San Francisco, CA;
Wilbur, W.J. and Lipman, D.J. (1983) Proc. Natl. Acad., Sci. USA 80:726-730.
[0082] Alternatively, alignment of sequences for comparison may be conducted by the local
identity algorithm of
Smith and Waterman (1981) Add. APL. Math 2:482, by the identity alignment algorithm of
Needleman and Wunsch (1970) J. Mol. Biol. 48:443, by the search for similarity methods of
Pearson and Lipman (1988) Proc. Natl. Acad. Sci. USA 85: 2444, by computerized implementations of these algorithms (GAP, BESTFIT, BLAST, FASTA,
and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group (GCG),
575 Science Dr., Madison, WI), or by inspection.
[0083] One example of algorithms that are suitable for determining percent sequence identity
and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described
in
Altschul et al. (1977) Nucl. Acids Res. 25:3389-3402 and
Altschul et al. (1990) J. Mol. Biol. 215:403-410, respectively. BLAST and BLAST 2.0 can be used, for example with the parameters described
herein, to determine percent sequence identity for the polynucleotides and polypeptides
described herein. Software for performing BLAST analyses is publicly available through
the National Center for Biotechnology Information.
[0084] In one illustrative example, cumulative scores can be calculated using, for nucleotide
sequences, the parameters M (reward score for a pair of matching residues; always
>0) and N (penalty score for mismatching residues; always <0). Extension of the word
hits in each direction are halted when: the cumulative alignment score falls off by
the quantity X from its maximum achieved value; the cumulative score goes to zero
or below, due to the accumulation of one or more negative-scoring residue alignments;
or the end of either sequence is reached. The BLAST algorithm parameters W, T and
X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide
sequences) uses as defaults a word length (W) of 11, and expectation (E) of 10, and
the BLOSUM62 scoring matrix (see
Henikoff and Henikoff (1989) Proc. Natl. Acad. Sci. USA 89: 10915) alignments, (B) of 50, expectation (E) of 10, M=5, N=-4 and a comparison of both
strands.
[0085] For amino acid sequences, a scoring matrix can be used to calculate the cumulative
score. Extension of the word hits in each direction are halted when: the cumulative
alignment score falls off by the quantity X from its maximum achieved value; the cumulative
score goes to zero or below, due to the accumulation of one or more negative-scoring
residue alignments; or the end of either sequence is reached. The BLAST algorithm
parameters W, T and X determine the sensitivity and speed of the alignment.
[0086] In one approach, the "percentage of sequence identity" is determined by comparing
two optimally aligned sequences over a window of comparison of at least 20 positions,
wherein the portion of the polynucleotide or polypeptide sequence in the comparison
window may comprise additions or deletions (i.e., gaps) of 20 percent or less, usually
5 to 15 percent, or 10 to 12 percent, as compared to the reference sequences (which
does not comprise additions or deletions) for alignment of the two sequences. The
percentage is calculated by determining the number of positions at which the identical
nucleic acid bases or amino acid residues occur in both sequences to yield the number
of matched positions, dividing the number of matched positions by the total number
of positions in the reference sequence (i.e., the window size) and multiplying the
results by 100 to yield the percentage of sequence identity.
[0087] "Homology" refers to the percentage of residues in the polynucleotide or polypeptide
sequence variant that are identical to the non-variant sequence after aligning the
sequences and introducing gaps, if necessary, to achieve the maximum percent homology.
[0088] "Binding affinity" may refer to a binding dissociate constant (Kd) or an apparent
affinity (
e.g., EC50) value.
BRIEF DESCRIPTION OF THE DRAWINGS
[0089]
Figure 1 illustrates the number of screened subjects from the Zurich Primary HIV Infection
Cohort Study with a genotype predicting sensitivity to GS-9722 (elipovimab). Pre-ART
plasma samples from 92 individuals were analyzed in the GenoSure HIV Envelope RNA
Assay. "None," indicates all screened individuals without selection for specific amino
acids in the HIV envelope gene. Amino acid positions indicated for each category.
Figure 2 illustrates the number of screened clade B subjects from the Zurich Primary
HIV Infection Cohort Study with a genotype predicting sensitivity to GS-9722. Pre-ART
plasma samples from 59 clade B infected individuals were analyzed in the GenoSure
HIV Envelope RNA Assay. "None," indicates all screened individuals without selection
for specific amino acids in the HIV envelope gene. Amino acid positions indicated
for each category.
Figure 3 illustrates the sensitivity to GS-9722 for swarm viruses derived from pre-ART
plasma samples from the Zurich Primary HIV Infection Cohort Study. Virus from 29 samples
with positive predictive values of 80.7% or higher were analyzed in the PHENOSENSE® HIV Entry Assay (Monogram Biosciences). Amino acid positions indicated for each category.
Figure 4 illustrates the sensitivity to GS-9722 for viruses subcloned from swarm viruses
derived from pre-ART plasma samples from the Zurich Primary HIV Infection Cohort Study.
Twenty individual viruses from four pre-ART plasma samples, where swarm viruses were
predicted sensitive by genotyping and tested sensitive by phenotyping, were analyzed
in the PHENOSENSE® HIV Entry Assay (Monogram Biosciences). Solid line indicates IC50 for swarm virus.
DETAILED DESCRIPTION
1. Introduction
[0090] The present anti-HIV gp120 V3 glycan directed antibody or antigen-binding fragment
thereof, as defined by the claims, for use in in a method of treating or preventing
HIV and
in vitro methods are based, in part, on the unexpected discovery of HIV-infected patient populations
who are responsive to the administration of an anti-HIV gp120 V3-glycan directed antibody
or antigen-binding fragment thereof, in the absence of co-administration of additional
anti-HIV antibodies directed against other HIV antigens (
e.g., gp41) or non-overlapping epitopes of the same HIV antigen (
e.g., directed against gp120 in the region of the CD4 binding site or V2 apex region).
Such patients are infected with a species of HIV having a gp120 protein that is bound
by a V3-glycan directed antibody or antigen-binding fragment thereof.
[0091] Generally, the methods entail identifying a human subject who is infected with an
HIV or a population of HIV expressing a gp120 comprising: a glycosylated asparagine
at the position corresponding to amino acid residue position 332 (N332glycan), an
aspartate at the position corresponding to amino acid residue position 325 (D325),
and one or more amino acid of: a threonine at the position corresponding to amino
acid residue position 63 (T63), a leucine at the position corresponding to amino acid
residue position 179 (L179), a threonine at the position corresponding to amino acid
residue position 320 (T320), and a histidine at the position corresponding to amino
acid residue position 330 (H330), wherein the amino acid positions are with reference
to SEQ ID NO: 4 (
i.e., residues 1-511 of NCBI Ref Seq No. NP_057856.1). In various embodiments, the glycan
is an oligomannose.
2. Identification of Subjects Responsive to Treatment with an anti-HIV gp120 V3-Glycan
Directed Antibody or Antigen-Binding Fragment Thereof.
[0092] In some embodiments, the patient is identified by receiving a report of the HIV species
infecting the patient that identifies the HIV gp120 amino acids residues present at
the designated amino acid positions of interest, at positions 332 and 325, 179 and
330 and one or more amino acid positions from the group consisting of: 63 and 320,
wherein the amino acid positions are with reference to SEQ ID NO: 4. In some embodiments,
the patient is identified by conducting one or more assays (polynucleotide or polypeptide
sequencing) to determine the amino acid sequence(s) of the gp120 or the amino acid
residues present at the designated amino acid positions of interest of the gp120 protein(s)
of the HIV species infecting the patient. Identification of the full length or partial
sequences of the gp120 proteins obtained from the subject can be determined at the
polynucleotide or polypeptide level. In some embodiments, the amino acids present
at the gp120 residue positions of interest are determined at the polypeptide level.
[0093] Disclosed but not within the literal scope of the claims, the methods may entail
identifying a subject infected with an HIV or a population of HIV expressing a gp120
comprising N332glycan, D325 and T63, wherein the amino acid positions are with reference
to SEQ ID NO: 4.
[0094] Disclosed but not within the literal scope of the claims, the methods may entail
identifying a subject infected with an HIV or a population of HIV expressing a gp120
comprising N332glycan, D325 and L179, wherein the amino acid positions are with reference
to SEQ ID NO: 4.
[0095] Disclosed but not within the literal scope of the claims, the methods may entail
identifying a subject infected with an HIV or a population of HIV expressing a gp120
comprising N332glycan, D325 and T320, wherein the amino acid positions are with reference
to SEQ ID NO: 4.
[0096] Disclosed but not within the literal scope of the claims, the methods may entail
identifying a subject infected with an HIV or a population of HIV expressing a gp120
comprising N332glycan, D325 and H330, wherein the amino acid positions are with reference
to SEQ ID NO: 4.
[0097] Disclosed but not within the literal scope of the claims, the methods may entail
identifying a subject infected with an HIV or a population of HIV expressing a gp120
comprising N332glycan, D325, T63 and L179, wherein the amino acid positions are with
reference to SEQ ID NO: 4.
[0098] Disclosed but not within the literal scope of the claims, the methods may entail
identifying a subject infected with an HIV or a population of HIV expressing a gp120
comprising N332glycan, D325, T63 and T320, wherein the amino acid positions are with
reference to SEQ ID NO: 4.
[0099] In some embodiments, the subject is infected with HIV clade B viruses. Disclosed
but not within the literal scope of the claims, the methods may entail identifying
a subject infected with an HIV or a population of HIV expressing a gp120 comprising
N332glycan, D325, T63 and H330, wherein the amino acid positions are with reference
to SEQ ID NO: 4. In the claimed invention, the methods entail identifying a subject
infected with an HIV or a population of HIV expressing a gp120 comprising N332glycan,
D325, L179, and H330, wherein the amino acid positions are with reference to SEQ ID
NO: 4. In various embodiments of the claimed invention, the methods entail identifying
a subject infected with an HIV or a population of HIV expressing a gp120 comprising
N332glycan, D325, T63, L179, T320 and H330, wherein the amino acid positions are with
reference to SEQ ID NO: 4.
[0100] Disclosed but not within the literal scope of the claims, the methods may entail
identifying a subject infected with an HIV or a population of HIV expressing a gp120
comprising N332glycan, D325, T320 and H330, wherein the amino acid positions are with
reference to SEQ ID NO: 4.
[0101] In various embodiments of the claimed invention, the methods entail identifying a
subject infected with an HIV or a population of HIV expressing a gp120 comprising
N332glycan, D325, L179, T320 and H330, wherein the amino acid positions are with reference
to SEQ ID NO: 4. In some embodiments, the subject is infected with HIV clade A and/or
HIV clade C viruses. In some embodiments, the subject is infected with HIV clade A,
clade B and/or HIV clade C viruses.
[0102] Disclosed but not within the literal scope of the claims, the methods may entail
identifying a subject infected with an HIV or a population of HIV expressing a gp120
comprising N332glycan, D325, T63, L179 and T320, wherein the amino acid positions
are with reference to SEQ ID NO: 4.
[0103] In various embodiments of the claimed invention, the methods entail identifying a
subject infected with an HIV or a population of HIV expressing a gp120 comprising
N332glycan, D325, T63, L179 and H330, wherein the amino acid positions are with reference
to SEQ ID NO: 4.
[0104] In some embodiments, the subject is infected with an HIV or a population of HIV expressing
a gp120 further comprising one or more of the following amino acid residues: a glycan
at amino acid residue 301 (glycan301); a lysine at amino acid residue 677 (K677);
an amino acid residue other than tryptophan (Trp, W) (
e.g., alanine (Ala, A); cysteine (Cys, C); aspartate or aspartic acid (Asp, D); glutamate
or glutamic acid (Glu, E); phenylalanine (Phe, F); glycine (Gly, G); histidine (His,
H); isoleucine (Ile, I); lysine (Lys, K); leucine (Leu, L); methionine (Met, M); asparagine
(Asn, N); proline (Pro, P); glutamine (Gln, Q); arginine (Arg, R); serine (Ser, S);
Threonine (Thr, T); valine (Val, V) or tyrosine (Tyr, Y)) at position 17 (not_W17);
an amino acid residue other than arginine (
e.g., A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W or Y) at position 747 (not_R747);
an insertion_321.01(
e.g., an insertion of any amino acid (
e.g., A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W or Y) between position
G321 and K322); a glutamic acid at position 429 (E429); a glutamine at position 442
(Q442); an arginine at position 335 (R335); an isoleucine at position 165 (I165);
a serine at position 393 (S393); an isoleucine at position 307 (I307); a glycan at
position 295 (295 glycan); and/or an asparagine at position 300 (N300), wherein the
amino acid positions are with reference to SEQ ID NO: 4.
gp120
[0105] Envelope glycoprotein gp120 (or gp120) is a 120 kDa glycoprotein that is part of
the outer layer of HIV. It presents itself as viral membrane spikes consisting of
three molecules of gp120 linked together and anchored to the membrane by gp41 protein.
Gp120 is essential for viral infection as it facilitates HIV entry into the host cell
through its interaction with cell surface receptors. These receptors include DC-SIGN,
Heparan Sulfate Proteoglycan, and the CD4 receptor. Binding to CD4 on helper T-cells
induces the start of a cascade of conformational changes in gp120 and gp41 that lead
to the fusion of the virus with the host cell membrane.
[0106] Gp120 is encoded by the HIV
env gene. The
env gene encodes a gene product of around 850 amino acids. The primary
env product is the protein gp160, which gets cleaved to gp120 (about 480 amino acids)
and gp41 (about 345 amino acids) in the endoplasmic reticulum by the cellular protease
furin.
[0107] The V3 glycan site on gp120 is formed partly by a section of the CCR5 coreceptor
site and partly by the surrounding camouflaging glycans (so-called "high mannose patch")
(
Sok, et al., Immunity (2016) 45, 31-45). Broadly neutralizing antibodies (bnAbs) to the V3 glycan site are the most common
of all Abs found in HIV infection (
Walker, et al., PLoS Pathog. (2010) 6:e1001028 (2010);
Landais, et al., PLoS Pathog. (2016) 12:e1005369;
Georgiev, et al. Science (2013) 340:751-756). A consensus sequence of the V3 region of gp120 (
Milich et al., J Virol., 67(9):5623-5634 (1993) is provided below:
CTRPNNNTRKSIHIGPGRAFYTTGEIIGDIRQAHC (SEQ ID NO: 1).
[0108] The amino acid sequence of an exemplary gp160 polypeptide of HIV clone WITO is provided
below (the V3 hypervariable loop is boldened and the N332 potential N-linked glycosylation
site is boldened and underlined):

[0109] The amino acid sequence of an exemplary gp160 polypeptide of HIV clone identified
in NCBI Ref Seq No. NP_057856.1 is provided below (the V3 hypervariable loop is boldened
and the N332 potential N-linked glycosylation site is boldened and underlined):

[0110] The amino acid sequence of an exemplary gp120 polypeptide of HXB2 subtype B HIV-1
isolate (GenBank Accession No. K0345; corresponding to residues 1-511 of NCBI Ref
Seq No. NP_057856.1) is provided below (the V3 hypervariable loop is boldened and
the N332 potential N-linked glycosylation site is boldened and underlined; signal
peptide is underlined):

[0111] The amino acid sequence of an exemplary gp120 polypeptide is provided below:

[0112] The amino acid sequence of another exemplary gp120 polypeptide (see, bioafrica.net/proteomics/ENV-GP120prot.html)
is provided below:

[0113] Genomic diversity among independent human immunodeficiency virus type 1 (HIV-1) isolates,
to a lesser degree among sequential isolates from the same patients, and even within
a single patient isolate is a well-known feature of HIV-1. Although this sequence
heterogeneity is distributed throughout the genome, most of the heterogeneity is located
in the
env gene. Comparison of predicted amino acid sequences from several different isolates
has shown that sequence heterogeneity is clustered in five variable regions (designated
V1 through V5) of the surface glycoprotein, gp120. The V3 region, although only 35
amino acids long, exhibits considerable sequence variability. Interestingly, despite
this variability, the V3 region includes determinants that mediate interactions with
CD4+ cells. The increase in gp120 variability results in higher levels of viral replication,
suggesting an increase in viral fitness in individuals infected by diverse HIV-1 variants.
Variability in potential N-linked glycosylation sites (PNGSs) also result in increased
viral fitness. PNGSs allow for the binding of long-chain carbohydrates to the high
variable regions of gp120. Thus, the number of PNGSs in
env might affect the fitness of the virus by providing more or less sensitivity to neutralizing
antibodies.
Biological Sample
[0114] The HIV gp120 amino acid residues of interest are determined from HIV present or
suspected to be present in a biological sample from the subject. The biological sample
can be from a solid tissue or biological fluid of the subject known or suspected to
contain HIV. In various embodiments, the biological sample comprises or is from blood,
peripheral blood mononuclear cells (PBMCs), serum, plasma, semen or lymph nodes. In
some embodiments, the biological sample comprises or is from bile, blood, blood plasma,
serum, breast milk, feces, pus, saliva, sebum, semen, sweat, tears, urine, or vomit.
In patients whose virus levels are suppressed, e.g., by antiretroviral (ART) therapy,
the biological sample comprises solid tissue or biological fluid of the subject known
or suspected to contain an HIV reservoir,
e.g., solid tissues and/or biological fluids comprising latently HIV-infected CD4+ T cells
(including memory and non-memory effector CD4+ T cells), hematopoietic progenitors
of CD4+ T cells, γδT cells (including memory and non-memory effector γδT cells), natural
killer (NK) cells, myeloid cells (including monocytes and macrophages), hematopoietic
progenitors of myeloid cells and follicular dendritic cells. Anatomical reservoirs
that may harbor latently HIV-infected cells include lymphoid tissues, the brain and
the central nervous system, the gastrointestinal tract and the gut-associated lymphoid
tissue (GALT), genital tract, lungs and skin. Tissues and cells found to harbor latently
HIV infected cells and HIV reservoirs are described,
e.g., in
Kuo, et al., Curr Opin HIV AIDS. (2018) 13(2): 137-142;
Mzingwane, et al., Rev Med Virol. (2017) Mar;27(2), doi: 10. 1002/rmv. 1924 (PMID
28128885);
Churchill, et al., Nat Rev Microbiol. (2016) 14(1):55-60;
Barton, et al., Trends Microbiol. (2016) 24(5):345-355.
[0115] In some embodiments, multiple biological samples are evaluated from a single patient.
For example, in some embodiments two or more biological samples from two or more different
tissues or two or more different anatomical reservoirs are evaluated from a single
patient.
Stage of Infection
[0116] In various embodiments, the human subject is an adult, a juvenile or an infant. The
subject may be symptomatic (
e.g., viremic) or asymptomatic (
e.g., acutely infected or ART suppressed). In some embodiments, the human subject is
acutely infected or recently infected with HIV. In certain embodiments, the subject
has not seroconverted. In some embodiments, the human subject is chronically infected
with HIV. The subject many or may not be receiving a regimen of antiretroviral therapy
(ART).
[0117] Patients can be categorized into Fiebig stages I-VI, which are based on a sequential
gain in positive HIV-1 clinical diagnostic assays (viral RNA measured by PCR, p24
and p31 viral antigens measured by enzyme-linked immunosorbent assay (ELISA). p24
antigen is a viral core protein that transiently appears in the blood during the ramp-up
phase once HIV-1 RNA levels rise above 10,000 copies/mL and before the development
of detectable HIV antibodies. In Fiebig stage I, during ramp-up viremia, only HIV-1
RNA in the blood can be detected. Fiebig stage II commences about 7 days later, when
results of tests to detect p24 antigen become positive. In Fiebig stage III, within
about 5 days after p24 antigen test results become positive, IgM anti-HIV-1 antibodies
can be detected with sufficiently sensitive enzyme immunoassays (EIAs) (
e.g., third-generation EIAs). Stage III typically occurs 1-2 weeks after the onset of
acute retroviral symptoms. Fiebig stage IV represents the development of an indeterminate
Western blot test and occurs about 3 days after EIA tests show positive results. Conversion
to a clearly positive Western blot test, Fiebig stage V, generally occurs after another
7 days, or about 1 month after initial infection. Fiebig stages of HIV infection are
described,
e.g., in
Fiebig, et al., AIDS. (2003) 17(13):1871-9;
Cohen, et al., J Infect Dis. (2010) 202 Suppl 2:S270-7; and
McMichael, et al., Nature Reviews Immunology (2010) 10:11-23. In some embodiments, the biological sample evaluated is from a human subject having
an HIV infection of Fiebig stage IV or earlier,
e.g., Fiebig stage I, Fiebig stage II, Fiebig stage III or Fiebig stage IV. In some embodiments,
the biological sample evaluated is from a human subject having an HIV infection of
an HIV infection of Fiebig stage V or Fiebig stage VI.
[0118] In some embodiments, the biological sample has been obtained from the subject. Disclosed
but not within the literal scope of the claims, the methods entail receiving a report
of the HIV gp120 amino acids residues present at the designated positions of interest,
e.g., at 332 and 325, and one or more amino acid positions from the group consisting of:
63, 179, 320 and 330, wherein the amino acid positions are with reference to SEQ ID
NO: 4.
Determining gp120 Amino Acids of Interest
[0119] Determination of the amino acid residues at HIV gp120 sequences of a subject at the
designated positions of interest,
e.g., at 332, 325, 179 and 330 and one or more amino acid positions from the group consisting
of: 63, and 320 , wherein the amino acid positions are with reference to SEQ ID NO:
4, can be done at the polynucleotide or polypeptide level. At the level of the polynucleotide,
HIV RNA or proviral DNA isolated from one or more biological samples can be sequenced
using methods known in the art. In some embodiments, HIV RNA or proviral DNA isolated
from two or more biological samples of a subject are sequenced. In some embodiments,
the two or more biological samples have been obtained from different tissue sources
(
e.g., blood, peripheral blood mononuclear cells, lymph nodes and/or semen). In some embodiments,
the two or more biological samples have been obtained at different time points,
e.g., 1, 2, 3, 4, 5, 6, 7 or 8 weeks apart, 3, 4, 5, 6, 7, 8, 9, 10, 11 or 12 months apart.
[0120] As appropriate, primers that anneal to and amplify the HIV
env coding sequence, and particularly the V3 variable region of gp120, can be used. In
some embodiments, nested sets of primers can be used. In various embodiments, the
RNA is sequenced directly or reverse-transcriptase polymerase chain reaction (RT-PCR)
can be performed. In some embodiments, Sanger sequencing can be performed,
e.g., when sequencing to determine amino acid residues in the V3 region, or when sequencing
a sample from a patient in an early Fiebig stage of disease,
e.g., prior to Fiebig stage III,
e.g., Fiebig stages I or II. In various embodiments, single genome amplification (SGA)
and sequencing is performed. Methods for single genome amplification (SGA) and sequencing
of plasma HIV virion RNA, are described,
e.g., in
Salazar-Gonzalez, et al. (2008) J Virol 82:3952-3970; and
Keele, et al., Proc Natl Acad Sci USA. (2008) 105(21):7552-7. Application of SGA to determining amino acid sequence variance in HIV gp120 sequences,
and which can be employed in the herein described methods, is described,
e.g., in
Bar, et al., N Engl J Med. (2016) 375(21):2037-2050; and
Mendoza, et al., Nature. (2018) 561(7724):479-484. In various embodiments, high throughput, Next Generation Sequencing (NGS), massively
parallel or deep sequencing techniques are employed to sequence gp120, including at
least the V3 variable region, from a population of HIV species in one or more biological
samples from a single patient or subject. In such cases, multiple nucleic acid sequences
encoding at least the V3 variable region of gp120 are sequenced and aligned. In some
embodiments, the full-length of gp120 is sequenced. Illustrative platforms for performing
NGS sequencing that can be used for determining the gp120 sequences of HIV species
in one or more biological samples from a patient include Illumina (Solexa) (illumina.com),
Ion torrent: Proton / PGM sequencing (thermofisher.com), SOLiD (thermofisher.com),
and Single Molecule, Real-Time (SMRT) Sequencing (Pacific Biosciences, pacb.com).
Methods for isolating and sequencing HIV gp120, including at least the V3 glycan region,
from patients, and which can be applied in the present methods, are described in,
e.g., Shioda, et al., J Virol. (1997) 71(7):4871-81;
Colón, et al., J Virol Antivir Res. (2015) 4(3). pii: 143 (PMID: 27358904);
Kafando, et al., PLoS One. (2017) 12(12):e0189999;
Hebberecht, et al., PLoS One. (2018) 13(4):e0195679,
Andrews, et al., Sci Rep. (2018) 8(1):5743 and
Landais, et al. Immunity. (2017) 47(5):990-1003. As appropriate, shorter sequence reads of the nucleic acid sequences ("contigs")
can be assembled into longer sequences, including at least the V3 variable region
of gp120. Methods of contig assembly of HIV genomic sequences that can be applied
in the present methods are described,
e.g., in
Huang, et al., Bioinformation. (2018) 14(8):449-454;
Hiener, et al., J Vis Exp. (2018) Oct 16;(140). doi: 10.3791/58016; and
Wymant, et al., Virus Evol. (2018) May 18;4(1):vey007. doi: 10.1093/ve/vey007.
[0121] Disclosed but not within the literal scope of the claims, at least 90%, at least
91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least
97%, at least 98%, at least 99%, or 100%, of the sequenced V3 variable region of gp120
in a population of HIV obtained from one or more biological samples in a single patient
comprise an amino acid sequence comprising a glycosylated asparagine at the position
corresponding to amino acid residue position 332 (N332glycan), an aspartate at the
position corresponding to amino acid residue position 325 (D325), a leucine at the
position corresponding to amino acid residue position 179 (L179), a histidine at the
position corresponding to amino acid residue position 330 (H330), and one or more
of a threonine at the position corresponding to amino acid residue position 63 (T63),
and a threonine at the position corresponding to amino acid residue position 320 (T320),
wherein the amino acid positions are with reference to SEQ ID NO: 4. As used herein,
numbering of a given amino acid polymer or nucleic acid polymer "corresponds to",
is "corresponding to" or is "relative to" the numbering of a selected or reference
amino acid polymer or nucleic acid polymer when the position of any given polymer
component (
e.g., amino acid, nucleotide, also referred to generically as a "residue") is designated
by reference to the same or to an equivalent position (
e.g., based on an optimal alignment or a consensus sequence) in the selected amino acid
or nucleic acid polymer, rather than by the actual numerical position of the component
in the given polymer. In some embodiments, HIV gp120 variants are detected to a frequency
level about 1% (
e.g., 1% mutant or variant frequency) of the virus population. In some embodiments, HIV
gp120 variants are detected to a frequency level of about 0.5% of the virus population.
As a rule of thumb, reliable detection of variants at 1% frequency will require HIV
RNA levels of at least 1000 copies/mL.
See, e.g.,
Casadellà, et al., Virus Research 239 (2017) 69-81;
Noguera-Julian, et al., J Infect Dis. (2017) 216(suppl_9):S829-S833 and
Lee, et al., Sci Rep. (2020) 10(1): 1634.
3. Administration of an anti-HIV gp120 V3-Glycan Directed Antibody or Antigen-Binding
Fragment Thereof
[0122] In certain embodiments, the methods of treatment and
in vitro methods as defined by the claims entail the use of an anti-HIV antibody or antigen-binding
fragment thereof, or antigen binding molecule, that targets the V3 glycan binding
region of gp120, as defined by the claims.
[0123] HIV-1 is the main family of HIV and accounts for 95% of all infections worldwide.
HIV-2 is mainly seen in a few West African countries.
[0124] HIV viruses are divided into specific groups, M, N, O and P, of which M is the "major"
group and responsible for majority of HIV/AIDS globally. Based on their genetic sequence,
Group M is further subdivided into subtypes (also called clades) with prevalence in
distinct geographical locations.
[0125] A Group M "subtype" or "clade" is a subtype of HIV-1 group M defined by genetic sequence
data. Examples of Group M subtypes include Subtypes A-K. Some of the subtypes are
known to be more virulent or are resistant to different medications. There are also
"circulating recombinant forms" or CRFs derived from recombination between viruses
of different subtypes, which are each given a number. CRF12_BF, for example, is a
recombination between subtypes B and F. Subtype A is common in West Africa. Subtype
B is the dominant form in Europe, the Americas, Japan, Thailand, and Australia. Subtype
C is the dominant form in Southern Africa, Eastern Africa, India, Nepal, and parts
of China. Subtype D is generally only seen in Eastern and central Africa. Subtype
E has never been identified as a nonrecombinant, only recombined with subtype A as
CRF01_AE. Subtype F has been found in central Africa, South America and Eastern Europe.
Subtype G (and the CRF02_AG) have been found in Africa and central Europe. Subtype
H is limited to central Africa. Subtype I was originally used to describe a strain
that is now accounted for as CRF04_cpx, with the cpx for a "complex" recombination
of several subtypes. Subtype J is primarily found in North, Central and West Africa,
and the Caribbean Subtype K is limited to the Democratic Republic of Congo and Cameroon.
These subtypes are sometimes further split into sub-subtypes such as A1 and A2 or
F1 and F2. In 2015, the strain CRF19, a recombinant of subtype A, subtype D, and subtype
G, with a subtype D protease was found to be strongly associated with rapid progression
to AIDS in Cuba.
[0126] This disclosure provides,
inter alia, human anti-HIV neutralizing antibodies (e.g., broadly neutralizing Abs) that target
the V3-Glycan region of the gp120 polypeptide on the surface of HIV-infected cells.
Neutralizing antibodies against viral envelope proteins provide adaptive immune defense
against HIV-1 exposure by blocking the infection of susceptible cells. Broad neutralization
indicates that the antibodies can neutralize HIV-1 isolates from different clades.
Thus, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding fragments
described herein have cross-clade binding activity.
Antibodies and Antigen-Binding Fragments Thereof Directed to the V3 Glycan Region
of HIV gp120
[0127] In the invention, the methods of treatment and
in vitro methods, as defined by the claims, use an antibody or antigen-binding fragment thereof,
or an antigen-binding molecule that binds to HIV gp120 protein within the V3 Glycan
region, as defined by the claims. In certain embodiments, the administered antibody
or antigen-binding fragment thereof, or an antigen-binding molecule, as defined by
the clams, binds to HIV-1 antigens expressed on a cell surface and eliminates or kills
the infected cell.
[0128] A "neutralizing antibody" is one that can neutralize the ability of HIV to initiate
and/or perpetuate an infection in a host and/or in target cells in vitro. The disclosure
provides neutralizing monoclonal human antibodies, wherein the antibody recognizes
an antigen from HIV,
e.g., a gp120 polypeptide. In certain embodiments, a "neutralizing antibody" may inhibit
the entry of HIV-1 virus,
e.g., SF162 and/or JR-CSF, with a neutralization index >1.5 or >2.0 (
Kostrikis LG et al., J. Virol., 70(1): 445-458 (1996)).
[0129] By "broadly neutralizing antibodies" are meant antibodies that neutralize more than
one HIV-1 virus species (from diverse clades and different strains within a clade)
in a neutralization assay. A broad neutralizing antibody may neutralize at least 2,
3, 4, 5, 6, 7, 8, 9 or more different strains of HIV-1, the strains belonging to the
same or different clades. In particular embodiments, a broad neutralizing antibody
may neutralize multiple HIV-1 species belonging to at least 2, 3, 4, 5, or 6 different
clades. In certain embodiments, the inhibitory concentration of the anti-HIV gp120
V3 glycan directed antibody or antigen-binding fragment may be less than about 0.0001
µg/ml, less than about 0.001 µg/ml, less than about 0.01 µg/ml, less than about 0.1
µg/ml, less than about 0.5 µg/ml, less than about 1.0 µg/ml, less than about 5 µg/ml,
less than about 10 µg/ml, less than about 25 µg/ml, less than about 50 µg/ml, or less
than about 100 µg/ml to neutralize about 50% of the input virus in the neutralization
assay.
[0130] Illustrative broadly neutralizing antibodies that bind to gp120 in the third variable
loop (V3) and/or high mannose patch comprising a N332 oligomannose glycan and which
can be used in the herein described methods include without limitation GS-9722 (elipovimab),
GS-9721, PGT-121, PGT-121.66, PGT-121.414, PGT-122, PGT-123, PGT-124, PGT-125, PGT-126,
PGT-128, PGT-130, PGT-133, PGT-134, PGT-135, PGT-136, PGT-137, PGT-138, PGT-139, 10-1074,
10-1074-J, VRC24, 2G12, BG18, 354BG8, 354BG18, 354BG42, 354BG33, 354BG129, 354BG188,
354BG411, 354BG426, DH270.1, DH270.6, PGDM12, VRC41.01, PGDM21, PCDN-33A, BF520.1
and VRC29.03. Additional broadly neutralizing antibodies that bind to gp120 in the
third variable loop (V3) and/or high mannose patch comprising a N332 oligomannose
glycan and which can be used in the herein described methods are described,
e.g., in
WO 2012/030904;
WO 2014/063059;
WO 2016/149698;
WO 2017/106346;
WO 2018/075564,
WO 2018/125813;
WO 2018/237148,
WO 2019/226829,
WO 2020/023827,
WO2020/056145 and
Kerwin, et al., JPharm Sci. 2020 Jan;109(1):233-246
[0132] Disclosed but not within the literal scope of the claims, the anti-HIV gp120 V3 glycan-directed
antibody or antigen-binding fragment thereof comprises a VH comprising a VH-CDR1,
a VH-CDR2, and a VH-CDR3; and a VL comprising a VL-CDR1, a VL-CDR2, and a second VH-CDR3;
wherein the VH-CDR1, the VH-CDR2, the VH-CDR3 the VL-CDR1, the VL-CDR2, and the VH-CDR3
comprise the sequences set forth in: SEQ ID NOs.: 7, 8, 9, 10, 11 and 12; SEQ ID NOs.:
7, 13, 9, 10, 11 and 12; SEQ ID NOs.: 14, 15, 16, 17, 11 and 18; SEQ ID NOs.: 14,
19, 20, 17, 11 and 18; SEQ ID NOs.: 21, 22, 23, 24, 25 and 26; SEQ ID NOs.: 21, 22,
27, 24, 25 and 26; SEQ ID NOs.: 28, 29, 30, 31, 32 and 33; SEQ ID NOs.: 34, 35, 36,
37, 25 and 38; SEQ ID NOs.: 39, 40, 41, 42, 43 and 44; SEQ ID NOs.: 45, 46, 47, 48,
49 and 50; SEQ ID NOs.: 45, 51, 52, 53, 49 and 54; SEQ ID NOs.: 55, 56, 57, 58, 59
and 44; SEQ ID NOs.: 61, 46, 63, 58, 49 and 44; SEQ ID NOs.: 64, 65, 66, 67, 68 and
69; SEQ ID NOs.: 70, 71, 72, 73, 74 and 75; SEQ ID NOs.: 76, 77, 78, 79, 80 and 75;
SEQ ID NOs.: 81, 82, 83, 84, 85 and 75; SEQ ID NOs.: 85, 86, 87, 88, 89 and 90; SEQ
ID NOs.: 85, 91, 92, 93, 94 and 90; SEQ ID NOs.: 85, 96, 92, 93, 94 and 90; SEQ ID
NOs.: 85, 86, 87, 97, 98 and 90; SEQ ID NOs.: 85, 99, 100, 101, 102 and 95; SEQ ID
NOs.: 85, 99, 100, 101, 102 and 103; SEQ ID NOs.: 85, 99, 100, 104, 102 and 90; SEQ
ID NOs.: 85, 105, 92, 93, 94 and 90; SEQ ID NOs.: 85, 99, 100, 101, 102 and 107; SEQ
ID NOs.: 108, 109, 110, 111, 112, 113; SEQ ID NOs.: 108, 114, 115, 111, 116 and 117;
or SEQ ID NOs.: 108, 118, 119, 111, 120 and 121 (CDRs according to Kabat).
[0133] Disclosed but not within the literal scope of the claims, the anti-HIV gp120 V3 glycan-directed
antibody or antigen-binding fragment thereof comprises a VH comprising a VH-CDR1,
a VH-CDR2, and a VH-CDR3; and a VL comprising a VL-CDR1, a VL-CDR2, and a second VH-CDR3;
wherein the VH-CDR1, the VH-CDR2, the VH-CDR3 the VL-CDR1, the VL-CDR2, and the VH-CDR3
comprise the sequences set forth in: SEQ ID NOs.: 123, 124, 9, 10, 11 and 12; SEQ
ID NOs.: 125, 126, 16, 17, 11 and 18; SEQ ID NOs.: 127, 128, 20, 17, 11 and 18; SEQ
ID NOs.: 129, 130, 23, 24, 25 and 26; SEQ ID NOs.: 129, 130, 27, 24, 25 and 26; SEQ
ID NOs.: 131, 132, 30, 31, 32 and 33; SEQ ID NOs.: 133, 134, 36, 37, 25 and 38; SEQ
ID NOs.: 135, 136, 41, 42, 43 and 44; SEQ ID NOs.: 137, 138, 47, 48, 49 and 50; SEQ
ID NOs.: 137, 138, 52, 53, 49 and 54; SEQ ID NOs.: 139, 56, 57, 58, 59 and 44; SEQ
ID NOs.: 141, 138, 63, 58, 49 and 44; SEQ ID NOs.: 142, 143, 66, 67, 68 and 69; SEQ
ID NOs.: 144, 145, 72, 73, 74 and 75; SEQ ID NOs.: 146, 147, 78, 79, 80 and 75; SEQ
ID NOs.: 146, 147, 83, 84, 85 and 75; SEQ ID NOs.: 149, 150, 87, 88, 89 and 90; SEQ
ID NOs.: 151, 150, 87, 88, 89 and 90; SEQ ID NOs.: 152, 153, 92, 93, 94 and 90; SEQ
ID NOs.: 151, 150, 87, 97, 98 and 90; SEQ ID NOs.: 152, 153, 100, 101, 102 and 95;
SEQ ID NOs.: 152, 153, 100, 101, 102 and 103; SEQ ID NOs.: 152, 153, 100, 104, 102
and 90; SEQ ID NOs.: 152, 153, 100, 101, 102 and 107; SEQ ID NOs.: 154, 155, 110,
111, 116 and 117; SEQ ID NOs.: 156, 157, 115, 111, 116 and 117; or SEQ ID NOs.: 158,
159, 119, 111, 120 and 121 (CDRs according to Chothia).
[0134] Disclosed but not within the literal scope of the claims, the anti-HIV gp120 V3 glycan-directed
antibody or antigen-binding fragment thereof comprises a VH comprising a VH-CDR1,
a VH-CDR2, and a VH-CDR3; and a VL comprising a VL-CDR1, a VL-CDR2, and a second VH-CDR3;
wherein the VH-CDR1, the VH-CDR2, the VH-CDR3 the VL-CDR1, the VL-CDR2, and the VH-CDR3
comprise the sequences set forth in: SEQ ID NOs.: 160, 161, 162, 163, 164 and 12;
SEQ ID NOs.: 165, 166, 167, 168, 164 and 18; SEQ ID NOs.: 165, 166, 461, 168, 164
and 18; SEQ ID NOs.: 169, 170, 171, 168, 164 and 18; SEQ ID NOs.: 172, 173, 174, 175,
164 and 26; SEQ ID NOs.: 172, 173, 176, 175, 164 and 26; SEQ ID NOs.: 177, 178, 179,
180, 164 and 38; SEQ ID NOs.: 181, 182, 183, 184, 185 and 33; SEQ ID NOs.: 186, 187,
188, 189, 190 and 44; SEQ ID NOs.: 191, 192, 193, 194, 195 and 50; SEQ ID NOs.: 191,
196, 197, 198, 195 and 54; SEQ ID NOs.: 199, 200, 201, 202, 399 and 44; SEQ ID NOs.:
203, 204, 205, 202, 195 and 44; SEQ ID NOs.: 206, 207, 208, 209, 210 and 69; 211,
212, 213, 214, 215 and 75; SEQ ID NOs.: 216, 217, 218, 219, 220 and 75; SEQ ID NOs.:
221, 217, 83, 223, 224 and 75; SEQ ID NOs.: 225, 226, 87, 227, 228 and 90; SEQ ID
NOs.: 229, 226, 87, 227, 228 and 90; SEQ ID NOs.: 230, 231, 92, 232, 233 and 90; SEQ
ID NOs.: 230, 234, 92, 232, 233 and 90; SEQ ID NOs.: 229, 226, 87, 235, 398 and 90;
SEQ ID NOs.: 230, 236, 100, 232, 233 and 95; SEQ ID NOs.: 230, 236, 100, 232, 233
and 103; SEQ ID NOs.: 230, 236, 100, 237, 233 and 90; SEQ ID NOs.: 230, 238, 92, 232,
233 and 107; SEQ ID NOs.: 239, 240, 110, 241, 242 and 113; SEQ ID NOs.: 243, 244,
115, 241, 245 and 117; or SEQ ID NOs.: 243, 246, 119, 241, 247 and 121 (CDRs according
to IMGT).
[0135] Disclosed but not within the literal scope of the claims, the anti-HIV gp120 V3 glycan-directed
antibody or antigen-binding fragment thereof comprises a VH comprising a VH-CDR1,
a VH-CDR2, and a VH-CDR3; and a VL comprising a VL-CDR1, a VL-CDR2, and a second VH-CDR3;
wherein the VH-CDR1, the VH-CDR2, the VH-CDR3 the VL-CDR1, the VL-CDR2, and the VH-CDR3
comprise the sequences set forth in: SEQ ID NOs.: 248, 249, 250, 251, 252 and 253;
SEQ ID NOs.: 248, 254, 250, 251 252 and 253; SEQ ID NOs.: 255, 256, 257, 258, 252
and 259; SEQ ID NOs.: 260, 261, 262, 258, 252 and 259; SEQ ID NOs.: 263, 264, 265,
266, 267 and 268; SEQ ID NOs.: 263, 264, 397, 266, 267 and 268; SEQ ID NOs.: 269,
270, 271, 272, 273 and 274; SEQ ID NOs.: 275, 276, 277, 278, 279 and 280; SEQ ID NOs.:
281, 282, 283, 284, 285 and 286; SEQ ID NOs.: 287, 288, 289, 290, 291 and 286; SEQ
ID NOs.: 287, 292, 293, 294, 295 and 296; SEQ ID NOs.: 297, 298, 299, 300, 301 and
286; SEQ ID NOs.: 302, 288, 303, 300, 295 and 286; SEQ ID NOs.: 304, 305, 306, 307,
308 and 309; SEQ ID NOs.: 310, 311, 312, 313, 314 and 315; SEQ ID NOs.: 316, 316,
318, 319, 320 and 315; SEQ ID NOs.: 321, 322, 323, 324, 325 and 315; 326, 327, 328,
329, 330 and 331; SEQ ID NOs.: 332, 327, 328, 329, 330 and 331; SEQ ID NOs.: 333,
334, 335, 336, 337 and 338; SEQ ID NOs.: 333, 339, 335, 336, 337 and 338; SEQ ID NOs.:
332, 327, 328, 340, 341 and 338; SEQ ID NOs.: 342, 343, 344, 336, 345 and 346; SEQ
ID NOs.: 342, 343, 344, 336, 347 and 348; SEQ ID NOs.: 342, 343, 344, 349, 350 and
338; SEQ ID NOs.: 333, 351, 335, 336, 337 and 338; SEQ ID NOs.: 342, 343, 344, 336,
347 and 352; SEQ ID NOs: 353, 354, 355, 356, 357 and 358; SEQ ID NOs: 359, 360, 361,
356, 362 and 363; or SEQ ID NOs: 359, 364, 365, 356, 366 and 358. (CDRs according
to Honegger).
[0136] Illustrative CDR sequences of an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding
fragment thereof, useful in the methods described herein, are provided in Tables A1-A4.
[0137] In the claimed invention, the anti-HIV gp120 V3 glycan-directed antibody or antigen-binding
fragment thereof comprises VH and VL comprising amino acid sequences that are 100%,
identical to the amino acid sequences set forth, respectively, as selected from: SEQ
ID NOs.: 400 and 401; SEQ ID NOs.: 402 and 404; or SEQ ID NOs.: 405 and 406.
[0138] Disclosed but not within the literal scope of the claims, the anti-HIV gp120 V3 glycan-directed
antibody or antigen-binding fragment thereof comprises VH and VL comprising amino
acid sequences that are at least 80%, at least 85%, at least 90%, at least 91%, at
least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at
least 98%, at least 99%, or 100%, identical to the amino acid sequences set forth,
respectively, as selected from: SEQ ID NOs.: 402 and 403; SEQ ID NOs.: 462 and 463;
SEQ ID NOs.: 464 and 465;; SEQ ID NOs.: 466 and 467; SEQ ID NOs.: 407 and 408; SEQ
ID NOs.: 409 and 410; SEQ ID NOs.: 411 and 412; SEQ ID NOs.: 413 and 414; SEQ ID NOs.:
415 and 416; SEQ ID NOs.: 417 and 418; SEQ ID NOs.: 419 and 420; SEQ ID NOs.: 421
and 422; SEQ ID NOs.: 423 and 424; SEQ ID NOs.: 425 and 426; SEQ ID NOs.: 427 and
428; SEQ ID NOs.: 429 and 430; SEQ ID NOs.: 431 and 432; SEQ ID NOs.: 433 and 434;
SEQ ID NOs.: 435 and 436; SEQ ID NOs.: 437 and 438; SEQ ID NOs.: 439 and 440; SEQ
ID NOs.: 441 and 442; SEQ ID NOs.: 443 and 444; SEQ ID NOs.: 445 and 446; SEQ ID NOs.:
447 and 448; SEQ ID NOs.: 449 and 450; SEQ ID NOs.: 451 and 452; SEQ ID NOs.: 453
and 454; SEQ ID NOs.: 455 and 456; SEQ ID NOs.: 457 and 458; or SEQ ID NOs.: 459 and
460. Illustrative variable domain VH and VL sequences of an anti-HIV gp120 V3 glycan-directed
antibody or antigen-binding fragment thereof, useful in the methods described herein,
are provided in Table B.
[0139] Disclosed but not within the literal scope of the claims, the anti-HIV gp120 V3 glycan
directed antibody comprises VH and VL amino acid sequences that are at least 80%,
at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%,
at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical
to the amino acid sequences set forth below, respectively, and comprising one or more
of the following amino acids at the indicated positions (position numbering according
to Kabat): SEQ ID NOs.: 400 or 402, comprising one or more of: Ser-Ser-Val (SSV) or
Thr-Gly-Val (TGV) at positions 82a-82c, Gln (Q) at position 39, Asn (N) at position
60, His (H) at position 68, any one of Lys (K), His (H) or Thr (T) at position 105,
Leu (L) at position 2, Ala (A) at position 32, and/or Ala (A) at position 95; and
SEQ ID NOs.: 401, 403 or 404 comprising one or more of: Gly (G) at position 67, Tyr
(Y), Phe (F) or Thr (T) at position 67a, Arg (R) at position 67b, Pro (P) at position
67c, and/or Lys (K) at position 103. Disclosed but not within the literal scope of
the claims, the anti-HIV gp120 V3 glycan directed antibody comprises VH and VL amino
acid sequences that are at least 80%, at least 85%, at least 90%, at least 91%, at
least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at
least 98%, or at least 99% identical to the amino acid sequences set forth below,
respectively, and comprising one or more of the following amino acids at the indicated
positions (position numbering according to Kabat): SEQ ID NO.: 400 or 402, comprising
one or more of: Thr-Gly-Val (TGV) at positions 82a-82c, Asn (N) at position 60, His
(H) at position 68, any one of Lys (K), His (H) and/or Thr (T) at position 105; and
SEQ ID NOs.: 401, 403 or 404 comprising one or more of: Gly (G) at position 67, Tyr
(Y), Phe (F) or Thr (T) at position 67a, Arg (R) at position 67b, Pro (P) at position
67c.
Fc Mutations that Increase Serum Half-Life
[0140] In some embodiments, the Fc region or Fc domain of the anti-HIV gp120 V3 glycan directed
antibody as defined by the claims comprise amino acid modifications that promote an
increased serum half-life of the anti- binding molecule. Mutations that increase the
half-life of an antibody have been described. In one embodiment, the Fc region or
Fc domain of one or both of the CD3-targeting heavy chain and the HIV antigen-targeting
heavy chain comprise a methionine to tyrosine substitution at position 252 (EU numbering),
a serine to threonine substitution at position 254 (EU numbering), and a threonine
to glutamic acid substitution at position 256 (EU numbering). See, e.g.,
U.S. Patent No. 7,658,921. This type of mutant, designated as a "YTE mutant" exhibits a four-fold increased
half-life relative to wild-type versions of the same antibody (
Dall'Acqua, et al., J Biol Chem, 281: 23514-24 (2006);
Robbie, et al., Antimicrob Agents Chemotherap., 57(12):6147-6153 (2013)). In certain embodiments, the Fc region or Fc domain of one or both of the CD3-targeting
heavy chain and the HIV antigen-targeting heavy chain comprise an IgG constant domain
comprising one, two, three or more amino acid substitutions of amino acid residues
at positions 251-257, 285-290, 308-314, 385-389, and 428-436 (EU numbering). Alternatively,
M428L and N434S ("LS") substitutions can increase the pharmacokinetic half-life of
the multi-specific antigen binding molecule. In other embodiments, the Fc region or
Fc domain of one or both of the CD3-targeting heavy chain and the HIV antigen-targeting
heavy chain comprise a M428L and N434S substitution (EU numbering). In other embodiments,
the Fc region or Fc domain of one or both of the CD3-targeting heavy chain and the
HIV antigen-targeting heavy chain comprise T250Q and M428L (EU numbering) mutations.
In other embodiments, the Fc region or Fc domain of one or both of the CD3-targeting
heavy chain and the HIV antigen-targeting heavy chain comprise H433K and N434F (EU
numbering) mutations.
Fc Mutations that Enhance Effector Activity
[0141] In some embodiments, the Fc region or Fc domain of the anti-HIV gp120 V3 glycan directed
antibody, as defined by the claims, comprise post-translational and/or amino acid
modifications that increase effector activity, e.g., have improved FcγIIIa binding
and increased antibody-dependent cellular cytotoxicity (ADCC). In some embodiments,
the Fc region or Fc domain of the anti-HIV gp120 V3 glycan directed antibody comprises
DE modifications (
i.e., S239D and I332E by EU numbering) in the Fc region. In some embodiments, the Fc
region or Fc domain of the anti-HIV gp120 V3 glycan directed antibody, as defined
by the claims, comprises DEL modifications (
i.e., S239D, I332E and A330L by EU numbering) in the Fc region. In some embodiments, the
Fc region or Fc domain of the anti-HIV gp120 V3 glycan directed antibody, as defined
by the claims, comprises DEA modifications (
i.e., S239D, I332E and G236A by EU numbering) in the Fc region. In some embodiments, the
Fc region or Fc domain of the anti-HIV gp120 V3 glycan directed antibody, as defined
by the claims, comprises DEAL modifications (
i.e., S239D, I332E, G236A and A330L by EU numbering) in the Fc region.
See,
e.g.,
U.S. Patent Nos. 7,317,091;
7,662,925;
8,039,592;
8,093,357;
8,093,359;
8,383,109;
8,388,955;
8,735,545;
8,858,937;
8,937,158;
9,040,041;
9,353,187;
10,184,000; and
10,584,176. Additional amino acid modifications that increase effector activity,
e.
g., have improved FcγIIIa binding and increased antibody-dependent cellular cytotoxicity
(ADCC) include without limitation (EU numbering) F243L/R292P/Y300L/V305I/P396L; S298A/E333A/K334A;
or L234Y/L235Q/G236W/S239M/H268D/D270E/S298A on a first Fc domain and D270E/K326D/A330M/K334E
on a second Fc domain. Amino acid mutations that increase C1q binding and complement-dependent
cytotoxicity (CDC) include without limitation (EU numbering) S267E/H268F/S324T or
K326W/E333S. Fc region mutations that enhance effector activity are reviewed in,
e.g.,
Wang, et al., Protein Cell (2018) 9(1): 63-73; and
Saunders, Front Immunol. (2019) 10:1296.
[0142] In other embodiments, the anti-HIV gp120 V3 glycan directed antibody or antigen-binding
fragment thereof, as defined by the claims, has modified glycosylation, which,
e.g., may be introduced post-translationally or through genetic engineering. In some embodiments,
the anti-HIV gp120 V3 glycan directed antibody or antigen-binding fragment thereof,
as defined by the claims, is afucosylated,
e.g., at a glycosylation site present in the antibody or antigen-binding fragment thereof.
Most approved monoclonal antibodies are of the IgG1 isotype, where two N-linked biantennary
complex-type oligosaccharides are bound to the Fc region. The Fc region exercises
the effector function of ADCC through its interaction with leukocyte receptors of
the FcγR family. Afucosylated monoclonal antibodies are monoclonal antibodies engineered
so that the oligosaccharides in the Fc region of the antibody do not have any fucose
sugar units.
[0143] In some embodiments, as appropriate, the Fc region or Fc domain of the anti-HIV gp120
V3 glycan directed antibody, as defined by the claims, can comprise post-translational
and/or amino acid modifications for increasing serum half-life and enhancing effector
activity.
4. Combination Therapies with Two or More Anti-HIV Antibodies
[0144] In certain embodiments, this invention provides an anti-HIV gp120 V3 glycan directed
antibody or antigen-binding fragment thereof, as defined by the claims, for use in
a method for treating or preventing an HIV infection in a human subject having, or
at risk of having, the HIV infection, as defined by the claims. The method comprises
administering to the human subject a therapeutically effective amount of an anti-HIV
gp120 V3 glycan directed antibody or antigen-binding fragment, as defined by the claims,
or a pharmaceutical composition thereof, in combination with a therapeutically effective
amount of one or more (
e.g., one, two, three, one or two, or one to three) additional therapeutic agents. In
one embodiment, an anti-HIV gp120 V3 glycan directed antibody or antigen-binding fragment
thereof, as defined by the claims, is provided for use in a method for treating an
HIV infection in a human subject having or at risk of having the infection is provided,
the method comprising administering to the human subject a therapeutically effective
amount of an antibody or antibodies, as defined by the claims, or a pharmaceutically
acceptable salt thereof, in combination with a therapeutically effective amount of
one or more (
e.g., one, two, three, one or two, or one to three) additional therapeutic agents.
Antibody Combination Therapy
[0145] In some embodiments, the anti-V3-glycan antibody or antigen-binding fragment thereof,
as defined by the claims, is co-administered with a second anti-HIV antibody. In some
embodiments, the anti-V3-glycan antibody or antigen-binding fragment thereof, as defined
by the claims, is co-administered with a second anti-HIV antibody that binds to an
epitope or region of gp120 selected from the group consisting of: (i) second variable
loop (V2) and/or Env trimer apex; (ii) CD4 binding site (CD4bs); (iii) gp120/gp41
interface; or (v) silent face of gp120. The foregoing epitopes or regions of gp120
bound by broadly neutralizing antibodies are described,
e.g., in
McCoy, Retrovirology (2018) 15:70;
Sok and Burton, Nat Immunol. 2018 19(11):1179-1188;
Possas, et al., Expert Opin Ther Pat. 2018 Jul;28(7):551-560; and
Stephenson and Barouch, Curr HIV/AIDS Rep (2016) 13:31-37.
[0146] In some embodiments, the combination therapy entails co-administration of an anti-V3-glycan
antibody or antigen-binding fragment thereof, as defined by the claims, and another
anti-HIV broadly neutralizing antibody or bNAb (
i.e., a neutralizing antibody that neutralizes multiple HIV-1 viral strains). Various
bNAbs are known in the art and may be used as a combining therapeutic agent. Additional
illustrative bNAbs of use include, those that comprise VH and VL that bind to or compete
with an epitope or region of gp120 selected from the group consisting of: (i) second
variable loop (V2) and/or Env trimer apex; (ii) CD4 binding site (CD4bs); (iii) gp120/gp41
interface; or (v) silent face of gp120. Illustrative bNAbs for use in anti-HIV antibody
combination therapies include those that comprise VH and VL that bind to or compete
with 2F5, 4E10, M66.6, CAP206-CH12, 10E8, 10E8v4, 10E8-5R-100cF, DH511.11P, 7b2, and
LN01 (all of which bind the MPER of gp41); PG9, PG16, CH01-04 (all of which bind V1V2-glycan),
2G12 (which binds to outer domain glycan); b12, F105, VRC01, VRC07, VRC07-523, VRC03,
VRC06, VRC06b01 VRC08, VRC0801, NIH45-46, GS-9723, GS-5423, 3BNC117, 3BNC60, VRC-PG04,
PGV04; CH103, 44-VRC13.01, 1NC9, 12A12, N6, N6LS (VRC-HIVMAB091-00-AB), N49-P7, NC-Cow1,
IOMA, CH235 and CH235.12, N49P6, N49P7, N49P11, N49P9 and N60P25 (all of which bind
to the CD4 binding site).
[0147] In some embodiments, the combination therapy includes an antibody that binds to an
epitope or region of gp120 in the second variable loop (V2) and/or Env trimer apex
and competes with or comprises CDRs and/or VH and VL regions from an antibody selected
from the group consisting of PG9, PG16, PGC14, PGG14, PGT-142, PGT-143, PGT-144, PGT-145,
CH01, CH59, PGDM1400, CAP256, CAP256-VRC26.08, CAP256-VRC26.09, CAP256-VRC26.25, PCT64-24E
and VRC38.01.
[0148] In some embodiments, the combination therapy includes an antibody that binds to an
epitope or region of gp120 in the CD4 binding site (CD4bs) and competes with or comprises
CDRs and/or VH and VL regions from an antibody selected from the group consisting
of b12, F105, VRC01, VRC07, VRC07-523, VRC03, VRC06, VRC06b01 VRC08, VRC0801, NIH45-46,
GS-9723, GS-5423, 3BNC117, 3BNC60, VRC-PG04, PGV04; CH103, 44-VRC13.01, 1NC9, 12A12,
N6, N6LS (VRC-HIVMAB091-00-AB), N49-P7, NC-Cow1, IOMA, CH235 and CH235.12, N49P6,
N49P7, N49P11, N49P9 and N60P25.
[0149] In some embodiments, the combination therapy includes an antibody that binds to an
epitope or region of gp120 in the gp120/gp41 interface and competes with or comprises
CDRs and/or VH and VL regions from an antibody selected from the group consisting
of PGT-151, CAP248-2B, 35O22, 8ANC195, ACS202, VRC34 and VRC34.01.
[0150] In some embodiments, the combination therapy includes an antibody that binds to an
epitope or region of the gp120 silent face and competes with or comprises second VH
and VL regions from antibody VRC-PG05.
[0151] In some embodiments, the combination therapy includes an antibody that binds to an
epitope or region of gp41 in the membrane proximal region (MPER) and competes with
or comprises second VH and VL regions from an antibody selected from the group consisting
of 10E8, 10E8v4, 10E8-5R-100cF, 4E10, DH511.11P, 2F5, 7b2, and LN01. In some embodiments,
the combination therapy includes an antibody that binds to an epitope or region of
KLIC ("KLIC" disclosed as SEQ ID NO: 468), an immutable site of the transmembrane
protein gp41 and competes with or comprises second VH and VL regions from Clone 3
human monoclonal antibody (Cl3hmAb) (Protheragen).
See,
e.g.,
Vanini, et al., AIDS. (1993) 7(2):167-74.
[0152] In some embodiments, the combination therapy includes an antibody that binds to and
epitope or region of the gp41 fusion peptide and competes with or comprises second
VH and VL regions from an antibody selected from the group consisting of VRC34 and
ACS202.
[0153] In some embodiments, the combination therapy includes a multi-specific, e.g., a bispecific
or tri-specific antibody that binds to an HIV antigen. Examples of HIV bispecific
and trispecific antibodies include MGD014, B12BiTe, BiIA-SG, TMB-bispecific, SAR-441236,
VRC-01/PGDM-1400/10E8v4, 10E8.4/iMab, and 10E8v4/PGT121-VRC01.
[0154] Prior to administration, the bNAbs may be improved to have enhanced drug-like-properties,
reduced immunogenicity, enhanced ADCC, and suitable pharmacokinetic properties. Such
antibodies were shown to bind to the HIV envelope glycoprotein expressed on the surface
of virion or infected cells, and mediate both direct neutralization of the virus as
well as potent NK, Monocyte and PBMC killing of these cells. This property allows
the antibodies to treat HIV infections by neutralizing the virus, and also kill and
eliminate latently HIV infected cells in infected individuals, potentially leading
to a sterilizing cure for HIV.
[0155] In various embodiments, all antibodies administered in a combination anti-HIV antibody
therapy can have Fc and/or post-translational modifications that increase serum half-life
and/or enhance effector activity, as described above.
[0156] In various embodiments, the anti-HIV gp120 V3 glycan directed antibody or antigen-binding
fragments, as defined by the claims, and optionally combined bNAbs, can be
in vivo delivered,
e.g., expressed
in vivo from administered mRNA or engineered B-cells. Examples of
in vivo delivered bNAbs include AAV8-VRC07; mRNA encoding anti-HIV antibody VRC01; and engineered
B-cells encoding 3BNC117 (
Hartweger et al, J. Exp. Med. 2019, 1301).
5. Combination Therapies with Other Anti-HIV Therapeutic Agents
[0157] In certain embodiments, an anti-HIV gp120 V3 glycan directed antibody or antigen-binding
fragment thereof, as defined by the claims, is provided for use in a method for treating
or preventing an HIV infection in a human having or at risk of having the infection
is provided, as defined by the claims, comprising administering to the human a therapeutically
effective amount of the anti-HIV gp120 V3 glycan directed antibody or antigen-binding
fragments, , in combination with a therapeutically effective amount of one or more
(e.g., one, two, three, one or two, or one to three) additional therapeutic agents. In one
embodiment, an anti-HIV gp120 V3 glycan directed antibody or antigen-binding fragment
thereof, as defined by the claims, is provided for use in a method for treating an
HIV infection in a human having or at risk of having the infection is provided, comprising
administering to the human a therapeutically effective amount of the anti-HIV gp120
V3 glycan directed antibody or antigen-binding fragments, in combination with a therapeutically
effective amount of one or more
(e.g., one, two, three, one or two, or one to three) additional therapeutic agents.
[0158] In one embodiment, pharmaceutical compositions comprising the anti-HIV gp120 V3 glycan
directed antibody or antigen-binding fragments, as defined by the claims, in combination
with one or more (e.g., one, two, three, one or two, or one to three) additional therapeutic
agents, and a pharmaceutically acceptable carrier, diluent, or excipient are provided.
[0159] In certain embodiments, provided is an anti-HIV gp120 V3 glycan directed antibody
or antigen-binding fragment thereof, as defined by the claims, for use in methods
for treating an HIV infection, comprising administering to a patient in need thereof
a therapeutically effective amount of the anti-HIV gp120 V3 glycan directed antibody
or antigen-binding fragment thereof, in combination with a therapeutically effective
amount of one or more additional therapeutic agents which are suitable for treating
an HIV infection.
[0160] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibody or antigen-binding
fragment thereof, as defined by the claims, is combined with one, two, three, four,
or more additional therapeutic agents. In certain embodiments, the anti-HIV gp120
V3 glycan directed antibody or antigen-binding fragment thereof, as defined by the
claims, is combined with two additional therapeutic agents. In other embodiments,
the anti-HIV gp120 V3 glycan directed antibody or antigen-binding fragment thereof,
as defined by the claims is combined with three additional therapeutic agents. In
further embodiments, the anti-HIV gp120 V3 glycan directed antibody or antigen-binding
fragment thereof, as defined by the claims, is combined with four additional therapeutic
agents. The one, two, three, four, or more additional therapeutic agents can be different
therapeutic agents selected from the same class of therapeutic agents, (e.g., one
or more anti-HIV broadly neutralizing antibodies), and/or they can be selected from
different classes of therapeutic agents.
Administration of HIV Combination Therapy
[0161] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibody or antigen-binding
fragment thereof, as defined by the claims, is co-administered with one or more additional
therapeutic agents. Co-administration of an anti-HIV gp120 V3 glycan directed antibodies
or antigen-binding fragments disclosed herein with one or more additional therapeutic
agents generally refers to simultaneous or sequential administration of an anti-HIV
gp120 V3 glycan directed antibodies or antigen-binding fragments disclosed herein
and one or more additional therapeutic agents, such that therapeutically effective
amounts of the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding fragments
disclosed herein and the one or more additional therapeutic agents are both present
in the body of the patient. When administered sequentially, the combination may be
administered in two or more administrations.
[0162] Co-administration includes concurrent administration as well as administration of
unit dosages of the anti-HIV gp120 V3 glycan directed antibody or antigen-binding
fragment thereof, as defined by the claims, before or after administration of unit
dosages of one or more additional therapeutic agents. For example, the anti-HIV gp120
V3 glycan directed antibody or antigen-binding fragment thereof, as defined by the
claims, may be administered within seconds, minutes, hours or days of the administration
of the one or more additional therapeutic agents. In some embodiments, a unit dose
of an anti-HIV gp120 V3 glycan directed antibodies or antigen-binding fragments, as
defined by the claims, has been administered first, followed within seconds, minutes,
hours or days by administration of a unit dose of one or more additional therapeutic
agents. Alternatively, a unit dose of one or more additional therapeutic agents has
been administered first, followed by administration of a unit dose of an anti-HIV
gp120 V3 glycan directed antibodies or antigen-binding fragments, as defined by the
claims, within seconds, minutes, hours or days. In other embodiments, a unit dose
of an anti-HIV gp120 V3 glycan directed antibodies or antigen-binding fragments, as
defined by the claims, has been administered first, followed, after a period of hours
(e.g., 1-12 hours, 1-24 hours, 1-36 hours, 1-48 hours, 1-60 hours, 1-72 hours), by
administration of a unit dose of one or more additional therapeutic agents. In yet
other embodiments, a unit dose of one or more additional therapeutic agents has been
administered first, followed, after a period of hours (e.g., 1-12 hours, 1-24 hours,
1-36 hours, 1-48 hours, 1-60 hours, 1-72 hours), by administration of a unit dose
of an anti-HIV gp120 V3 glycan directed antibodies or antigen-binding fragments as
defined by the claims.
[0163] In certain embodiments, an anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, is combined with one or more additional therapeutic
agents in a unitary dosage form for simultaneous administration to a patient, for
example as a solid, liquid or suspension dosage form for oral, intravenous, intramuscular
or subcutaneous administration.
[0164] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are formulated as a liquid solution or suspension
which may optionally contain one or more other compounds useful for treating HIV.
In certain embodiments, the liquid solution or suspension can contain another active
ingredient for treating HIV, such as HIV protease inhibitors, HIV non-nucleoside or
non-nucleotide inhibitors of reverse transcriptase, HIV nucleoside or nucleotide inhibitors
of reverse transcriptase, HIV integrase inhibitors, HIV non-catalytic site (or allosteric)
integrase inhibitors, pharmacokinetic enhancers, and combinations thereof.
[0165] In certain embodiments, such liquid solutions or suspensions are suitable for once
daily, once weekly (
i.e., QW), once bi-weekly (
i.e. once every other week, or once every two weeks or Q2W), once monthly (
i.e., QM) or once bi-monthly dosing (
i.e. once every other month, or once every two months or Q2M) dosing or administration
intervals. In some embodiments, the anti-HIV gp120 V3 glycan directed antibodies or
antigen-binding fragments are administered once daily, once weekly (
i.e., QW), once bi-weekly (
i.e. once every other week, or once every two weeks or Q2W), once monthly (
i.e., QM), once bi-monthly dosing (
i.e. once every other month, or once every two months or Q2M), once every three months
(
i.e., Q3M), once every four months (
i.e., Q4M),
HIV Combination Therapy
[0166] In the above embodiments, the additional therapeutic agent may be an anti-HIV agent.
HIV protease inhibitors, HIV non-nucleoside or non-nucleotide inhibitors of reverse
transcriptase, HIV nucleoside or nucleotide inhibitors of reverse transcriptase, HIV
integrase inhibitors, HIV non-catalytic site (or allosteric) integrase inhibitors,
HIV entry inhibitors, HIV maturation inhibitors, HIV capsid inhibitors, HIV Tat or
Rev inhibitors, immunomodulators, (
e.g., immunostimulators), immunotherapeutic agents, immunomodulators, immunotherapeutic
agents, antibody-drug conjugates, gene modifiers, gene editors (such as CRISPR/Cas9,
zinc finger nucleases, homing nucleases, synthetic nucleases, TALENs), cell therapies
(such as chimeric antigen receptor T-cell, CAR-T, and engineered T-cell receptors,
TCR-T, autologous T-cell therapies), latency reversing agents, compounds that target
the HIV capsid, immune-based therapies, phosphatidylinositol 3-kinase (PI3K) inhibitors,
HIV antibodies, bispecific antibodies and "antibody-like" therapeutic proteins, HIV
p17 matrix protein inhibitors, IL-13 antagonists, peptidyl-prolyl cis-trans isomerase
A modulators, protein disulfide isomerase inhibitors, complement C5a receptor antagonists,
DNA methyltransferase inhibitor, Fatty acid synthase inhibitor, HIV vif gene modulators,
Vif dimerization antagonists, HIV-1 viral infectivity factor inhibitors, TAT protein
inhibitors, HIV-1 Nef modulators (e.g., Nef inhibitors), Hck tyrosine kinase modulators,
mixed lineage kinase-3 (MLK-3) inhibitors, HIV-1 splicing inhibitors, Rev protein
inhibitors, integrin antagonists, nucleoprotein inhibitors, splicing factor modulators,
COMM domain containing protein 1 modulators, HIV ribonuclease H inhibitors, retrocyclin
modulators, CDK-4 inhibitors, CDK-6 inhibitors, CDK-9 inhibitors, dendritic ICAM-3
grabbing nonintegrin 1 inhibitors, HIV GAG protein inhibitors, HIV POL protein inhibitors,
Complement Factor H modulators, ubiquitin ligase inhibitors, deoxycytidine kinase
inhibitors, cyclin dependent kinase inhibitors, proprotein convertase PC9 stimulators,
ATP dependent RNA helicase DDX3X inhibitors, reverse transcriptase priming complex
inhibitors, G6PD and NADH-oxidase inhibitors, mTOR complex 1 inhibitors, mTOR complex
2 inhibitors, P-Glycoprotein modulators, TAT protein inhibitors, prolylendopeptidase
inhibitors, Phospholipase A2 inhibitors, pharmacokinetic enhancers, HIV gene therapy,
TNF alpha ligand inhibitors, IFN antagonists, HIV vaccines, and combinations thereof.
[0167] In some embodiments, the additional therapeutic agent is selected from the group
consisting of combination drugs for HIV, other drugs for treating HIV, HIV protease
inhibitors, HIV reverse transcriptase inhibitors, HIV integrase inhibitors, HIV non-catalytic
site (or allosteric) integrase inhibitors, HIV entry (fusion) inhibitors, HIV maturation
inhibitors, latency reversing agents, HIV capsid inhibitors, HIV Tat or Rev inhibitors,
immunomodulators, (e.g., immunostimulators), immunotherapeutic agents, immune-based
therapies, PI3K inhibitors, HIV antibodies, and bispecific antibodies, and "antibody-like"
therapeutic proteins, and combinations thereof.
HIV Combination Drugs
[0168] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with one, two, three, four or more
additional anti-HIV therapeutic agents. Example anti-HIV therapeutic agents that can
be combined include without limitation ATRIPLA
® (efavirenz, tenofovir disoproxil fumarate, and emtricitabine); COMPLERA
® (EVIPLERA
®; rilpivirine, tenofovir disoproxil fumarate, and emtricitabine); STRIBILD
® (elvitegravir, cobicistat, tenofovir disoproxil fumarate, and emtricitabine); TRUVADA
® (tenofovir disoproxil fumarate and emtricitabine; TDF +FTC); DESCOVY
® (tenofovir alafenamide and emtricitabine); ODEFSEY
® (tenofovir alafenamide, emtricitabine, and rilpivirine); GENVOYA
® (tenofovir alafenamide, emtricitabine, cobicistat, and elvitegravir); BIKTARVY (bictegravir
+ emtricitabine + tenofovir alafenamide), adefovir; adefovir dipivoxil; cobicistat;
emtricitabine; tenofovir; tenofovir alafenamide and elvitegravir; tenofovir disoproxil;
tenofovir disoproxil fumarate; tenofovir alafenamide; tenofovir alafenamide hemifumarate;
TRIUMEQ
® (dolutegravir, abacavir, and lamivudine); dolutegravir, abacavir sulfate, and lamivudine;
raltegravir; PEGylated raltegravir; raltegravir and lamivudine; maraviroc; tenofovir
+ emtricitabine + maraviroc, enfuvirtide; ALUVIA
® (KALETRA
®; lopinavir and ritonavir); COMBIVIR
® (zidovudine and lamivudine; AZT+3TC); EPZICOM
® (LIVEXA
®; abacavir sulfate and lamivudine; ABC+3TC); TRIZIVIR
® (abacavir sulfate, zidovudine, and lamivudine; ABC+AZT+3TC); atazanavir and cobicistat;
atazanavir sulfate and cobicistat; atazanavir sulfate and ritonavir; darunavir; darunavir
and cobicistat; dolutegravir and rilpivirine; dolutegravir and rilpivirine hydrochloride;
dolutegravir, abacavir sulfate, and lamivudine; lamivudine, nevirapine, and zidovudine;
raltegravir and lamivudine; doravirine, lamivudine, and tenofovir disoproxil fumarate;
doravirine, lamivudine, and tenofovir disoproxil; dolutegravir + lamivudine, lamivudine
+ abacavir + zidovudine, lamivudine + abacavir, lamivudine + tenofovir disoproxil
fumarate, lamivudine + zidovudine + nevirapine, lopinavir + ritonavir, lopinavir +
ritonavir + abacavir + lamivudine, lopinavir + ritonavir + zidovudine + lamivudine,
tenofovir + lamivudine, and tenofovir disoproxil fumarate + emtricitabine + rilpivirine
hydrochloride, lopinavir , ritonavir, zidovudine and lamivudine; cabotegravir + rilpivirine;
elpida (elsulfavirine; VM-1500; VM-1500A); rilpivirine; rilpivirine hydrochloride;
atazanavir sulfate and cobicistat; atazanavir and cobicistat; darunavir and cobicistat;
atazanavir; atazanavir sulfate; dolutegravir; elvitegravir; ritonavir; atazanavir
sulfate and ritonavir; darunavir; lamivudine; prolastin; fosamprenavir; fosamprenavir
calcium efavirenz; efavirenz, lamivudine, and emtricitabine; etravirine; nelfinavir;
nelfinavir mesylate; interferon; didanosine; stavudine; indinavir; indinavir sulfate;
tenofovir and lamivudine; zidovudine; nevirapine; saquinavir; saquinavir mesylate;
aldesleukin; zalcitabine; tipranavir; amprenavir; delavirdine; delavirdine mesylate;
Radha-108 (receptol); lamivudine and tenofovir disoproxil fumarate; efavirenz, lamivudine,
and tenofovir disoproxil fumarate; phosphazid; lamivudine, nevirapine, and zidovudine;
abacavir; and abacavir sulfate.
Other HIV Drugs
[0169] [04] Examples of other drugs for treating HIV that can be combined with an agent
of this disclosure include aspemigrin C, acemannan, alisporivir, BanLec, deferiprone,
Gamimune, metenkefalin, naltrexone, Prolastin, REP 9, RPI-MN, VSSP, H1viral, SB-728-T,
1,5-dicaffeoylquinic acid, rHIV7-shl-TAR-CCR5RZ, AAV-eCD4-Ig gene therapy, MazF gene
therapy, BlockAide, bevirimat derivatives, ABX-464, AG-1105, APH-0812, bryostatin
analogs, BIT-225, CYT-107, CS-TATI-1, fluoro-beta-D-arabinose nucleic acid (FANA)-modified
antisense oligonucleotides, FX-101, griffithsin, HGTV-43, HPH-116, HS-10234, hydroxychloroquine,
IMB-10035, IMO-3100, IND-02, JL-18008, LADAVRU, MK-1376, MK-2048, MK-4250, MK-8507,
MK-8558, MK-8591 (islatravir), NOV-205, OB-002H, ODE-Bn-TFV, M1-TFV, PA-1050040 (PA-040),
PC-707, PGN-007, QF-036, S-648414, SCY-635, SB-9200, SCB-719, TR-452, TEV-90110, TEV-90112,
TEV-90111, TEV-90113, RN-18, DIACC-1010, Fasnall, Immuglo, 2-CLIPS peptide, HRF-4467,
thrombospondin analogs, TBL-1004HI, VG-1177, xl-081, rfhSP-D, [
18F]-MC-225, URMC-099-C, RES-529, and VIR-576.
HIV Protease Inhibitors
[0170] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with an HIV protease inhibitor.
Examples of HIV protease inhibitors include amprenavir, atazanavir, brecanavir, darunavir,
fosamprenavir, fosamprenavir calcium, indinavir, indinavir sulfate, lopinavir, nelfinavir,
nelfinavir mesylate, ritonavir, saquinavir, saquinavir mesylate, tipranavir, AEBL-2,
DG-17, GS-1156, TMB-657 (PPL-100), T-169, BL-008, MK-8122, TMB-607, GRL-02031 and
TMC-310911.
HIV ribonuclease H inhibitors
[0171] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with an HIV ribonuclease H inhibitor.
Examples of HIV ribonuclease H inhibitors that can be combined include NSC-727447.
HIV Nef inhibitors
[0172] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with an HIV Nef inhibitor. Examples
of HIV Nef inhibitors that can be combined with include FP-1.
HIV Reverse Transcriptase Inhibitors
[0173] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with a non-nucleoside or non-nucleotide
inhibitor. Examples of HIV non-nucleoside or non-nucleotide inhibitors of reverse
transcriptase include dapivirine, delavirdine, delavirdine mesylate, doravirine, efavirenz,
etravirine, lentinan, nevirapine, rilpivirine, ACC-007, ACC-008, AIC-292, F-18, KM-023,
PC-1005, VM-1500A-LAI, PF-3450074, elsulfavirine (sustained release oral, HIV infection),
elsulfavirine (long-acting injectable nanosuspension, HIV infection), and elsulfavirine
(VM-1500).
[0174] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with an HIV nucleoside or nucleotide
inhibitor. Examples of HIV nucleoside or nucleotide inhibitors of reverse transcriptase
include adefovir, adefovir dipivoxil, azvudine, emtricitabine, tenofovir, tenofovir
alafenamide, tenofovir alafenamide fumarate, tenofovir alafenamide hemifumarate, tenofovir
disoproxil, tenofovir disoproxil fumarate, tenofovir octadecyloxyethyl ester (AGX-1009),
tenofovir disoproxil hemifumarate, VIDEX
® and VIDEX EC
® (didanosine, ddl), abacavir, abacavir sulfate, alovudine, apricitabine, censavudine,
didanosine, elvucitabine, festinavir, fosalvudine tidoxil, CMX-157, dapivirine, doravirine,
etravirine, OCR-5753, tenofovir disoproxil orotate, fozivudine tidoxil, lamivudine,
phosphazid, stavudine, zalcitabine, zidovudine, rovafovir etalafenamide (GS-9131),
GS-9148, MK-8504, MK-8591, MK-858, VM-2500 and KP-1461.
HIV Integrase Inhibitors
[0175] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with an HIV integrase inhibitor.
Examples of HIV integrase inhibitors include elvitegravir, elvitegravir (extended-release
microcapsules), curcumin, derivatives of curcumin, chicoric acid, derivatives of chicoric
acid, 3,5-dicaffeoylquinic acid, derivatives of 3,5-dicaffeoylquinic acid, aurintricarboxylic
acid, derivatives of aurintricarboxylic acid, caffeic acid phenethyl ester, derivatives
of caffeic acid phenethyl ester, tyrphostin, derivatives of tyrphostin, quercetin,
derivatives of quercetin, raltegravir, PEGylated raltegravir, dolutegravir, JTK-351,
bictegravir, AVX-15567, cabotegravir (long-acting injectable), diketo quinolin-4-1
derivatives, integrase-LEDGF inhibitor, ledgins, M-522, M-532, MK-0536, NSC-310217,
NSC-371056, NSC-48240, NSC-642710, NSC-699171, NSC-699172, NSC-699173, NSC-699174,
stilbenedisulfonic acid, T-169, STP-0404, VM-3500 and cabotegravir.
[0176] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with a HIV non-catalytic site, or
allosteric, integrase inhibitor (NCINI). Examples of HIV non-catalytic site, or allosteric,
integrase inhibitors (NCINI) include CX-05045, CX-05168, and CX-14442.
HIV Entry Inhibitors
[0177] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with an HIV entry inhibitor. Examples
of HIV entry (fusion) inhibitors include AAR-501, LBT-5001, cenicriviroc, CCR5 inhibitors,
gp41 inhibitors, CD4 attachment inhibitors, gp120 inhibitors, gp160 inhibitors and
CXCR4 inhibitors.
[0178] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with a CCR5 inhibitor. Examples
of CCR5 inhibitors include aplaviroc, vicriviroc, maraviroc, maraviroc (long-acting
injectable nanoemulsion), cenicriviroc, leronlimab (PRO-140), adaptavir (RAP-101),
nifeviroc (TD-0232), anti-GP120/CD4 or CCR5 bispecific antibodies, B-07, MB-66, polypeptide
C25P, TD-0680, thioraviroc and vMIP (Haimipu).
[0179] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with a CXCR4 inhibitor. Examples
of CXCR4 inhibitors include plerixafor, ALT-1188, N15 peptide, and vMIP (Haimipu).
[0180] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with a gp41 inhibitor. Examples
of gp41 inhibitors include albuvirtide, enfuvirtide, griffithsin (gp41/gp120/gp160
inhibitor), BMS-986197, enfuvirtide biobetter, enfuvirtide biosimilar, HIV-1 fusion
inhibitors (P26-Bapc), ITV-1, ITV-2, ITV-3, ITV-4, CPT-31, Cl3hmAb, PIE-12 trimer
and sifuvirtide.
[0181] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with a CD4 attachment inhibitor.
Examples of CD4 attachment inhibitors include ibalizumab and CADA analogs
[0182] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with a gp120 inhibitor. Examples
of gp120 inhibitors include anti-HIV microbicide, Radha-108 (receptol) 3B3-PE38, BanLec,
bentonite-based nanomedicine, fostemsavir tromethamine, IQP-0831, VVX-004, and BMS-663068.
[0183] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with a gp160 inhibitor. Examples
of gp160 inhibitors that can be combined include fangchinoline.
HIV Maturation Inhibitors
[0184] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with an HIV maturation inhibitor.
Examples of HIV maturation inhibitors include BMS-955176, GSK-3640254 and GSK-2838232.
Latency Reversing Agents
[0185] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with an HIV latency reversing agent.
Examples of latency reversing agents that can be combined with the one or more multi-specific
antigen binding molecules, described herein, include IL-15 receptor agonists (
e.g., ALT-803; interleukin-15/Fc fusion protein (
e.g., XmAb24306); recombinant interleukin-15 (
e.g., AM0015, NIZ-985); pegylated IL-15 (
e.g., NKTR-255)); toll-like receptor (TLR) agonists (including TLR7 agonists,
e.g., GS-9620 and TLR8 agonists,
e.g., GS-9688), histone deacetylase (HDAC) inhibitors, proteasome inhibitors such as
velcade, protein kinase C (PKC) activators, Smyd2 inhibitors, BET-bromodomain 4 (BRD4)
inhibitors, ionomycin, IAP antagonists (inhibitor of apoptosis proteins, such as APG-1387,
LBW-242), SMAC mimetics (including TL32711, LCL161, GDC-0917, HGS1029, AT-406), Debio-1143,
PMA, SAHA (suberanilohydroxamic acid, or suberoyl, anilide, and hydroxamic acid),
NIZ-985, IL-15 modulating antibodies, (including IL-15, IL-15 fusion proteins and
IL-15 receptor agonists, e.g., ALT-803), JQ1, disulfiram, amphotericin B, and ubiquitin
inhibitors such as largazole analogs, APH-0812, and GSK-343. Examples of HDAC inhibitors
include romidepsin, vorinostat, and panobinostat. Examples of PKC activators include
indolactam, prostratin, ingenol B, and DAG-lactones.
Toll-Like Receptor (TLR) Agonists
[0186] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with an agonist of a toll-like receptor
(TLR),
e.g., an agonist of TLR1 (NCBI Gene ID: 7096), TLR2 (NCBI Gene ID: 7097), TLR3 (NCBI Gene
ID: 7098), TLR4 (NCBI Gene ID: 7099), TLR5 (NCBI Gene ID: 7100), TLR6 (NCBI Gene ID:
10333), TLR7 (NCBI Gene ID: 51284), TLR8 (NCBI Gene ID: 51311), TLR9 (NCBI Gene ID:
54106), and/or TLR10 (NCBI Gene ID: 81793). Example TLR7 agonists that can be co-administered
or combined with the one or more multi-specific antigen binding molecules, described
herein, include without limitation AL-034, DSP-0509, GS-9620 (vesatolimod), vesatolimod
analogs, LHC-165, TMX-101 (imiquimod), GSK-2245035, resiquimod, DSR-6434, DSP-3025,
IMO-4200, MCT-465, MEDI-9197, 3M-051, SB-9922, 3M-052, Limtop, TMX-30X, TMX-202, RG-7863,
RG-7854, RG-7795, and the compounds disclosed in
US20100143301 (Gilead Sciences),
US20110098248 (Gilead Sciences), and
US20090047249 (Gilead Sciences),
US20140045849 (Janssen),
US20140073642 (Janssen),
WO2014/056953 (Janssen),
WO2014/076221 (Janssen),
WO2014/128189 (Janssen),
US20140350031 (Janssen),
WO2014/023813 (Janssen),
US20080234251 (Array Biopharma),
US20080306050 (Array Biopharma),
US20100029585 (Ventirx Pharma),
US20110092485 (Ventirx Pharma),
US20110118235 (Ventirx Pharma),
US20120082658 (Ventirx Pharma),
US20120219615 (Ventirx Pharma),
US20140066432 (Ventirx Pharma),
US20140088085 (Ventirx Pharma),
US20140275167 (Novira Therapeutics), and
US20130251673 (Novira Therapeutics). An TLR7/TLR8 agonist that can be co-administered is NKTR-262, telratolimod and
BDB-001. Example TLR8 agonists that can be co-administered or combined with the one
or more multi-specific antigen binding molecules, described herein, include without
limitation E-6887, IMO-4200, IMO-8400, IMO-9200, MCT-465, MEDI-9197, motolimod, resiquimod,
GS-9688, VTX-1463, VTX-763, 3M-051, 3M-052, and the compounds disclosed in
US20140045849 (Janssen),
US20140073642 (Janssen),
WO2014/056953 (Janssen),
WO2014/076221 (Janssen),
WO2014/128189 (Janssen),
US20140350031 (Janssen),
WO2014/023813 (Janssen),
US20080234251 (Array Biopharma),
US20080306050 (Array Biopharma),
US20100029585 (Ventirx Pharma),
US20110092485 (Ventirx Pharma),
US20110118235 (Ventirx Pharma),
US20120082658 (Ventirx Pharma),
US20120219615 (Ventirx Pharma),
US20140066432 (Ventirx Pharma),
US20140088085 (Ventirx Pharma),
US20140275167 (Novira Therapeutics), and
US20130251673 (Novira Therapeutics). Example TLR9 agonists that can be co-administered include without limitation AST-008,
cobitolimod, CMP-001, IMO-2055, IMO-2125, litenimod, MGN-1601, BB-001, BB-006, IMO-3100,
IMO-8400, IR-103, IMO-9200, agatolimod, DIMS-9054, DV-1079, DV-1179, AZD-1419, lefitolimod
(MGN-1703), CYT-003, CYT-003-QbG10, tilsotolimod and PUL-042. Examples of TLR3 agonist
include rintatolimod, poly-ICLC, RIBOXXON
®, Apoxxim, RIBOXXIM
®, IPH-33, MCT-465, MCT-475, and ND-1.1. Examples of TLR4 agonist include G-100, and
GSK-1795091.
Histone Deacetylase (HDAC) Inhibitors
[0187] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with an inhibitor of a histone deacetylase,
e.g., histone deacetylase 1, histone deacetylase 9 (HDAC9, HD7, HD7b, HD9, HDAC, HDAC7,
HDAC7B, HDAC9B, HDAC9FL, HDRP, MITR; Gene ID: 9734). Examples of HDAC inhibitors include
without limitation, abexinostat, ACY-241, AR-42, BEBT-908, belinostat, CKD-581, CS-055
(HBI-8000), CT-101, CUDC-907 (fimepinostat), entinostat, givinostat, mocetinostat,
panobinostat, pracinostat, quisinostat (JNJ-26481585), resminostat, ricolinostat,
romidepsin, SHP-141, TMB-ADC, valproic acid (VAL-001), vorinostat, tinostamustine,
remetinostat, and entinostat.
Cyclin-Dependent Kinase (CDK) inhibitors or antagonists
[0188] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with an inhibitor or antagonist
of a cyclin-dependent kinase (CDK), e.g., cyclin dependent kinase 4 (CDK4; NCBI Gene
ID: 1019), cyclin dependent kinase 6 (CDK6; NCBI Gene ID: 1021), cyclin dependent
kinase 9 (CDK9; NCBI Gene ID: 1025). In some embodiments, the CDK4/CDK6/CDK9 inhibitor
or antagonist is selected from the group consisting of VS2-370.
Stimulator of Interferon Genes (STING) agonists
[0189] In some embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with an stimulator of interferon
genes (STING). In some embodiments, the STING receptor agonist or activator is selected
from the group consisting of ADU-S100 (MIW-815), SB-11285, MK-1454, SR-8291, AdVCA0848,
GSK-532, SYN-STING, MSA-1, SR-8291, 5,6-dimethylxanthenone-4-acetic acid (DMXAA),
cyclic-GAMP (cGAMP) and cyclic-di-AMP.
RIG-I Agonists
[0190] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with an agonist of DExD/H-box helicase
58 (DDX58;
a.k.a., RIG-I, RIG1, RIGI, RLR-1, SGMRT2; NCBI Gene ID: 23586). In some embodiments, the
agents as defined by the claims are combined with a RIG-I modulator such as RGT-100,
or NOD2 modulator, such as SB-9200 (
a.k.a., GS 9992; inarigivir), and IR-103. An illustrative RIG-I agonist is KIN1148, described
by
Hemann, et al., J Immunol May 1, 2016, 196 (1 Supplement) 76.1. Additional RIG-I agonists are described, e.g., in
Elion, et al., Cancer Res. (2018) 78(21):6183-6195; and
Liu, et al., J Virol. (2016) 90(20):9406-19. RIG-I agonists are commercially available, e.g., from Invivogen (invivogen.com).
LAG-3 and TIM-3 inhibitors
[0191] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with an anti-TIM-3 (
a.k.a., hepatitis A virus cellular receptor 2 antibody (HAVCR2; NCBI Gene ID: 84868), such
as TSR-022, LY-3321367, MBG-453, INCAGN-2390. In some embodiments, the anti-HIV gp120
V3 glycan directed antibodies or antigen-binding fragments, as defined by the claims,
are combined with an anti-LAG-3 (Lymphocyte-activation) (NCBI Gene ID: 3902) antibody,
such as relatlimab (ONO-4482), LAG-525, MK-4280, REGN-3767, INCAGN2385.
Capsid Inhibitors
[0192] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with a capsid inhibitor. Examples
of capsid inhibitors that can be combined with an agent of this disclosure include
capsid polymerization inhibitors or capsid disrupting compounds, HIV nucleocapsid
p7 (NCp7) inhibitors such as azodicarbonamide, HIV p24 capsid protein inhibitors,
GS-6207, GS-CA1, AVI-621, AVI-101, AVI-201, AVI-301, and AVI-CAN1-15 series, PF-3450074,
and compounds described in Intl. Patent Publ. No.
WO 2019/087016.
Immune-based Therapies
[0193] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with an immune-based therapy. Examples
of immune-based therapies include toll-like receptor (TLR) modulators such as TLR1,
TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLR10, TLR11, TLR12, AND TLR13; programmed
cell death protein 1 (PD-1) modulators; programmed death-ligand 1 (PD-L1) modulators;
IL-15 modulators (
e.g., IL-15 receptor agonists (
e.g., ALT-803; interleukin-15/Fc fusion protein (
e.g., XmAb24306); recombinant interleukin-15 (
e.g., AM0015, NIZ-985); pegylated IL-15 (
e.g., NKTR-255)); DermaVir; interleukin-7; plaquenil (hydroxychloroquine); proleukin (aldesleukin,
IL-2); interferon alfa; interferon alfa-2b; interferon alfa-n3; pegylated interferon
alfa; interferon gamma; hydroxyurea; mycophenolate mofetil (MPA) and its ester derivative
mycophenolate mofetil (MMF); ribavirin; polymer polyethyleneimine (PEI); gepon; IL-12;
WF-10; VGV-1; MOR-22; BMS-936559; CYT-107, normferon, peginterferon alfa-2a, peginterferon
alfa-2b, RPI-MN, STING modulators, RIG-I modulators, NOD2 modulators, SB-9200, and
IR-103.
[0194] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with a TLR agonist. Examples of
TLR agonists include without limitation: vesatolimod (GS-9620), lefitolimod, tilsotolimod,
rintatolimod, DSP-0509, AL-034, G-100, cobitolimod, AST-008, motolimod, GSK-1795091,
GSK-2245035, VTX-1463, GS-9688, LHC-165, BDB-001, RG-7854, telratolimod.
Immune Checkpoint Receptor Protein Modulators
[0195] In various embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with one or more blockers or inhibitors
of inhibitory immune checkpoint proteins or receptors and/or with one or more stimulators,
activators or agonists of one or more stimulatory immune checkpoint proteins or receptors.
Blockade or inhibition of inhibitory immune checkpoints can positively regulate T-cell
or NK cell activation and prevent immune escape of infected cells. Activation or stimulation
of stimulatory immune check points can augment the effect of immune checkpoint inhibitors
in infective therapeutics. In various embodiments, the immune checkpoint proteins
or receptors regulate T cell responses (
e.g., reviewed in
Xu, et al., J Exp Clin Cancer Res. (2018) 37:110). In various embodiments, the immune checkpoint proteins or receptors regulate NK
cell responses (
e.g., reviewed in
Davis, et al., Semin Immunol. (2017) 31:64-75 and
Chiossone, et al., Nat Rev Immunol. (2018) 18(11):671-688).
[0196] Examples of immune checkpoint proteins or receptors that can be combined with the
anti-HIV gp120 V3 glycan directed antibodies or antigen-binding fragments, as defined
by the claims, include without limitation CD27, CD70; CD40, CD40LG; CD47, CD48 (SLAMF2),
transmembrane and immunoglobulin domain containing 2 (TMIGD2, CD28H), CD84 (LY9B,
SLAMF5), CD96, CD160, MS4A1 (CD20), CD244 (SLAMF4); CD276 (B7H3); V-set domain containing
T cell activation inhibitor 1 (VTCN1, B7H4); V-set immunoregulatory receptor (VSIR,
B7H5, VISTA); immunoglobulin superfamily member 11 (IGSF11, VSIG3); natural killer
cell cytotoxicity receptor 3 ligand 1 (NCR3LG1, B7H6); HERV-H LTR-associating 2 (HHLA2,
B7H7); inducible T cell co-stimulator (ICOS, CD278); inducible T cell costimulator
ligand (ICOSLG, B7H2); TNF receptor superfamily member 4 (TNFRSF4, OX40); TNF superfamily
member 4 (TNFSF4, OX40L); TNFRSF8 (CD30), TNFSF8 (CD30L); TNFRSF10A (CD261, DR4, TRAILR1),
TNFRSF9 (CD137), TNFSF9 (CD137L); TNFRSF10B (CD262, DR5, TRAILR2), TNFRSF10 (TRAIL);
TNFRSF14 (HVEM, CD270), TNFSF14 (HVEML); CD272 (B and T lymphocyte associated (BTLA));
TNFRSF17 (BCMA, CD269), TNFSF13B (BAFF); TNFRSF18 (GITR), TNFSF18 (GITRL); MHC class
I polypeptide-related sequence A (MICA); MHC class I polypeptide-related sequence
B (MICB); CD274 (CD274, PDL1, PD-L1); programmed cell death 1 (PDCD1, PD1, PD-1);
cytotoxic T-lymphocyte associated protein 4 (CTLA4, CD152); CD80 (B7-1), CD28; nectin
cell adhesion molecule 2 (NECTIN2, CD112); CD226 (DNAM-1); Poliovirus receptor (PVR)
cell adhesion molecule (PVR, CD155); PVR related immunoglobulin domain containing
(PVRIG, CD112R); T cell immunoreceptor with Ig and ITIM domains (TIGIT); T cell immunoglobulin
and mucin domain containing 4 (TIMD4; TIM4); hepatitis A virus cellular receptor 2
(HAVCR2, TIMD3, TIM3); galectin 9 (LGALS9); lymphocyte activating 3 (LAG3, CD223);
signaling lymphocytic activation molecule family member 1 (SLAMF1, SLAM, CD150); lymphocyte
antigen 9 (LY9, CD229, SLAMF3); SLAM family member 6 (SLAMF6, CD352); SLAM family
member 7 (SLAMF7, CD319); UL16 binding protein 1 (ULBP1); UL16 binding protein 2 (ULBP2);
UL16 binding protein 3 (ULBP3); retinoic acid early transcript 1E (RAET1E; ULBP4);
retinoic acid early transcript 1G (RAET1G; ULBP5); retinoic acid early transcript
1L (RAET1L; ULBP6); lymphocyte activating 3 (CD223); killer cell immunoglobulin like
receptor, three Ig domains and long cytoplasmic tail 1 (KIR, CD158E1); killer cell
lectin like receptor C1 (KLRC1, NKG2A, CD159A); killer cell lectin like receptor K1
(KLRK1, NKG2D, CD314); killer cell lectin like receptor C2 (KLRC2, CD159c, NKG2C);
killer cell lectin like receptor C3 (KLRC3, NKG2E); killer cell lectin like receptor
C4 (KLRC4, NKG2F); killer cell immunoglobulin like receptor, two Ig domains and long
cytoplasmic tail 1 (KIR2DL1); killer cell immunoglobulin like receptor, two Ig domains
and long cytoplasmic tail 2 (KIR2DL2); killer cell immunoglobulin like receptor, two
Ig domains and long cytoplasmic tail 3 (KIR2DL3); killer cell immunoglobulin like
receptor, three Ig domains and long cytoplasmic tail 1 (KIR3DL1); killer cell lectin
like receptor D1 (KLRD1); and SLAM family member 7 (SLAMF7).
[0197] In various embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with one or more blockers or inhibitors
of one or more T-cell inhibitory immune checkpoint proteins or receptors. Illustrative
T-cell inhibitory immune checkpoint proteins or receptors include without limitation
CD274 (CD274, PDL1, PD-L1); programmed cell death 1 ligand 2 (PDCD1LG2, PD-L2, CD273);
programmed cell death 1 (PDCD1, PD1, PD-1); cytotoxic T-lymphocyte associated protein
4 (CTLA4, CD152); CD276 (B7H3); V-set domain containing T cell activation inhibitor
1 (VTCN1, B7H4); V-set immunoregulatory receptor (VSIR, B7H5, VISTA); immunoglobulin
superfamily member 11 (IGSF11, VSIG3); TNFRSF14 (HVEM, CD270), TNFSF14 (HVEML); CD272
(B and T lymphocyte associated (BTLA)); PVR related immunoglobulin domain containing
(PVRIG, CD112R); T cell immunoreceptor with Ig and ITIM domains (TIGIT); lymphocyte
activating 3 (LAG3, CD223); hepatitis A virus cellular receptor 2 (HAVCR2, TIMD3,
TIM3); galectin 9 (LGALS9); killer cell immunoglobulin like receptor, three Ig domains
and long cytoplasmic tail 1 (KIR, CD158E1); killer cell immunoglobulin like receptor,
two Ig domains and long cytoplasmic tail 1 (KIR2DL1); killer cell immunoglobulin like
receptor, two Ig domains and long cytoplasmic tail 2 (KIR2DL2); killer cell immunoglobulin
like receptor, two Ig domains and long cytoplasmic tail 3 (KIR2DL3); and killer cell
immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 1 (KIR3DL1).
In various embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with one or more agonist or activators
of one or more T-cell stimulatory immune checkpoint proteins or receptors. Illustrative
T-cell stimulatory immune checkpoint proteins or receptors include without limitation
CD27, CD70; CD40, CD40LG; inducible T cell costimulator (ICOS, CD278); inducible T
cell costimulator ligand (ICOSLG, B7H2); TNF receptor superfamily member 4 (TNFRSF4,
OX40); TNF superfamily member 4 (TNFSF4, OX40L); TNFRSF9 (CD137), TNFSF9 (CD137L);
TNFRSF18 (GITR), TNFSF18 (GITRL); CD80 (B7-1), CD28; nectin cell adhesion molecule
2 (NECTIN2, CD 112); CD226 (DNAM-1); CD244 (2B4, SLAMF4), Poliovirus receptor (PVR)
cell adhesion molecule (PVR, CD155). See,
e.g.,
Xu, et al., J Exp Clin Cancer Res. (2018) 37:110.
[0198] In various embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with one or more blockers or inhibitors
of one or more NK-cell inhibitory immune checkpoint proteins or receptors. Illustrative
NK-cell inhibitory immune checkpoint proteins or receptors include without limitation
killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail
1 (KIR, CD158E1); killer cell immunoglobulin like receptor, two Ig domains and long
cytoplasmic tail 1 (KIR2DL1); killer cell immunoglobulin like receptor, two Ig domains
and long cytoplasmic tail 2 (KIR2DL2); killer cell immunoglobulin like receptor, two
Ig domains and long cytoplasmic tail 3 (KIR2DL3); killer cell immunoglobulin like
receptor, three Ig domains and long cytoplasmic tail 1 (KIR3DL1); killer cell lectin
like receptor C1 (KLRC1, NKG2A, CD159A); and killer cell lectin like receptor D1 (KLRD1,
CD94). In various embodiments, the anti-HIV gp120 V3 glycan directed antibodies or
antigen-binding fragments, as defined by the claims, are combined with one or more
agonist or activators of one or more NK-cell stimulatory immune checkpoint proteins
or receptors. Illustrative NK-cell stimulatory immune checkpoint proteins or receptors
include without limitation CD16, CD226 (DNAM-1); CD244 (2B4, SLAMF4); killer cell
lectin like receptor K1 (KLRK1, NKG2D, CD314); SLAM family member 7 (SLAMF7). See,
e.g.,
Davis, et al., Semin Immunol. (2017) 31:64-75;
Fang, et al., Semin Immunol. (2017) 31:37-54; and
Chiossone, et al., Nat Rev Immunol. (2018) 18(11):671-688.
[0199] In some embodiments, the one or more immune checkpoint inhibitors comprises a proteinaceous
(e.g., antibody or fragment thereof, or antibody mimetic) inhibitor of PD-L1 (CD274),
PD-1 (PDCD1) or CTLA4. In some embodiments, the one or more immune checkpoint inhibitors
comprises a small organic molecule inhibitor of PD-L1 (CD274), PD-1 (PDCD1) or CTLA4.
[0200] Examples of inhibitors of CTLA4 that can be co-administered include without limitation
ipilimumab, tremelimumab, BMS-986218, AGEN1181, AGEN1884, BMS-986249, MK-1308, REGN-4659,
ADU-1604, CS-1002, BCD-145, APL-509, JS-007, BA-3071, ONC-392, AGEN-2041, JHL-1155,
KN-044, CG-0161, ATOR-1144, PBI-5D3H5, BPI-002, as well as multi-specific inhibitors
FPT-155 (CTLA4/PD-L1/CD28), PF-06936308 (PD-1/ CTLA4), MGD-019 (PD-1/CTLA4), KN-046
(PD-1/CTLA4), MEDI-5752 (CTLA4/PD-1), XmAb-20717 (PD-1/CTLA4), and AK-104 (CTLA4/PD-1).
[0201] Examples of inhibitors of PD-L1 (CD274) or PD-1 (PDCD1) that can be co-administered
include without limitation pembrolizumab, nivolumab, cemiplimab, pidilizumab, AMP-224,
MEDI0680 (AMP-514), spartalizumab, atezolizumab, avelumab, durvalumab, BMS-936559,
CK-301, PF-06801591, BGB-A317 (tislelizumab), GLS-010 (WBP-3055), AK-103 (HX-008),
AK-105, CS-1003, HLX-10, MGA-012, BI-754091, AGEN-2034, JS-001 (toripalimab), JNJ-63723283,
genolimzumab (CBT-501), LZM-009, BCD-100, LY-3300054, SHR-1201, SHR-1210 (camrelizumab),
Sym-021, ABBV-181 (budigalimab), PD1-PIK, BAT-1306, (MSB0010718C), CX-072, CBT-502,
TSR-042 (dostarlimab), MSB-2311, JTX-4014, BGB-A333, SHR-1316, CS-1001 (WBP-3155,
KN-035, IBI-308 (sintilimab), HLX-20, KL-A167, STI-A1014, STI-A1015 (IMC-001), BCD-135,
FAZ-053, TQB-2450, MDX1105-01, GS-4224, GS-4416, INCB086550, MAX10181, as well as
multi-specific inhibitors FPT-155 (CTLA4/PD-L1/CD28), PF-06936308 (PD-1/ CTLA4), MGD-013
(PD-1/LAG-3), FS-118 (LAG-3/PD-L1) MGD-019 (PD-1/CTLA4), KN-046 (PD-1/CTLA4), MEDI-5752
(CTLA4/PD-1), RO-7121661 (PD-1/TIM-3), XmAb-20717 (PD-1/CTLA4), AK-104 (CTLA4/PD-1),
M7824 (PD-L1/TGFβ-EC domain), CA-170 (PD-L1/VISTA), CDX-527 (CD27/PD-L1), LY-3415244
(TIM3/PDL1), and INBRX-105 (4-1BB/PDL1).
[0202] In some embodiments, the small molecule inhibitor of CD274 or PDCD1 is selected from
the group consisting of GS-4224, GS-4416, INCB086550 and MAX10181. In some embodiments,
the small molecule inhibitor of CTLA4 comprises BPI-002.
[0203] In various embodiments, the antibodies or antigen-binding fragments as, as defined
by the claims, are combined with anti-TIGIT antibodies, such as BMS-986207, RG-6058,
AGEN-1307
TNF Receptor Superfamily (TNFRSF) Member Agonists or Activators
[0204] In various embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with an agonist of one or more TNF
receptor superfamily (TNFRSF) members, e.g., an agonist of one or more of TNFRSF1A
(NCBI Gene ID: 7132), TNFRSF1B (NCBI Gene ID: 7133), TNFRSF4 (OX40, CD134; NCBI Gene
ID: 7293), TNFRSF5 (CD40; NCBI Gene ID: 958), TNFRSF6 (FAS, NCBI Gene ID: 355), TNFRSF7
(CD27, NCBI Gene ID: 939), TNFRSF8 (CD30, NCBI Gene ID: 943), TNFRSF9 (4-1BB, CD137,
NCBI Gene ID: 3604), TNFRSF10A (CD261, DR4, TRAILR1, NCBI Gene ID: 8797), TNFRSF10B
(CD262, DR5, TRAILR2, NCBI Gene ID: 8795), TNFRSF10C (CD263, TRAILR3, NCBI Gene ID:
8794), TNFRSF10D (CD264, TRAILR4, NCBI Gene ID: 8793), TNFRSF11A (CD265, RANK, NCBI
Gene ID: 8792), TNFRSF11B (NCBI Gene ID: 4982), TNFRSF12A (CD266, NCBI Gene ID: 51330),
TNFRSF13B (CD267, NCBI Gene ID: 23495), TNFRSF13C (CD268, NCBI Gene ID: 115650), TNFRSF16
(NGFR, CD271, NCBI Gene ID: 4804), TNFRSF17 (BCMA, CD269, NCBI Gene ID: 608), TNFRSF18
(GITR, CD357, NCBI Gene ID: 8784), TNFRSF19 (NCBI Gene ID: 55504), TNFRSF21 (CD358,
DR6, NCBI Gene ID: 27242), and TNFRSF25 (DR3, NCBI Gene ID: 8718).
[0205] Example anti-TNFRSF4 (OX40) antibodies that can be co-administered include without
limitation, MEDI6469, MEDI6383, MEDI0562 (tavolixizumab), MOXR0916, PF-04518600, RG-7888,
GSK-3174998, INCAGN1949, BMS-986178, GBR-8383, ABBV-368, and those described in
WO2016179517,
WO2017096179,
WO2017096182,
WO2017096281, and
WO2018089628.
[0206] Example anti-TNFRSF5 (CD40) antibodies that can be co-administered include without
limitation RG7876, SEA-CD40, APX-005M and ABBV-428.
[0207] In some embodiments, the anti-TNFRSF7 (CD27) antibody varlilumab (CDX-1127) is co-administered.
[0208] Example anti-TNFRSF9 (4-1BB, CD137) antibodies that can be co-administered include
without limitation urelumab, utomilumab (PF-05082566), AGEN2373 and ADG-106.
[0209] Example anti-TNFRSF18 (GITR) antibodies that can be co-administered include without
limitation, MEDI1873, FPA-154, INCAGN-1876, TRX-518, BMS-986156, MK-1248, GWN-323,
and those described in
WO2017096179,
WO2017096276,
WO2017096189, and
WO2018089628. In some embodiments, an antibody, or fragment thereof, co-targeting TNFRSF4 (OX40)
and TNFRSF18 (GITR) is co-administered. Such antibodies are described,
e.g., in
WO2017096179 and
WO2018089628.
Interleukin receptor agonists
[0210] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with an interleukin receptor agonist,
such as IL-2, IL-7, IL-15, IL-10, IL-12 agonists; examples of IL-2 receptor agonists
such as proleukin (aldesleukin, IL-2); pegylated IL-2 (
e.g., NKTR-214); modified variants of IL-2 (
e.g., THOR-707), bempegaldesleukin, AIC-284, ALKS-4230, CUI-101, Neo-2/15; IL-15 receptor
agonists, such as ALT-803, NKTR-255, and hetIL-15, interleukin-15/Fc fusion protein,
AM-0015, NIZ-985, SO-C101, IL-15 Synthorin (pegylated IL-15), P-22339, and a IL-15
-PD-1 fusion protein N-809; examples of IL-7 include CYT-107.
[0211] Examples of additional interleukin receptor agonists that can be combined with the
anti-HIV gp120 V3 glycan directed antibodies or antigen-binding fragments, as defined
by the claims, include interferon alfa; interferon alfa-2b; interferon alfa-n3; pegylated
interferon alfa; interferon gamma; Flt3 agonists such as CDX-301; gepon; normferon,
peginterferon alfa-2a, peginterferon alfa-2b, RPI-MN.
Bi-and Tri-Specific Natural Killer (NK)-Cell Engagers
[0212] In various embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with a bi-specific NK-cell engager
(BiKE) or a tri-specific NK-cell engager (TriKE) (e.g., not having an Fc) or bi-specific
antibody (e.g., having an Fc) against an NK cell activating receptor,
e.g., CD16A, C-type lectin receptors (CD94/NKG2C, NKG2D, NKG2E/H and NKG2F), natural cytotoxicity
receptors (NKp30, NKp44 and NKp46), killer cell C-type lectin-like receptor (NKp65,
NKp80), Fc receptor FcγR (which mediates antibody-dependent cell cytotoxicity), SLAM
family receptors (
e.g., 2B4, SLAM6 and SLAM7), killer cell immunoglobulin-like receptors (KIR) (KIR-2DS
and KIR-3DS), DNAM-1 and CD137 (4-1BB). Illustrative anti-CD16 bi-specific antibodies,
BiKEs or TriKEs that can be co-administered include AFM26 (BCMA/CD16A) and AFM-13
(CD16/CD30). As appropriate, the anti-CD16 binding bi-specific molecules may or may
not have an Fc. BiKEs and TriKEs are described, e.g., in
Felices, et al., Methods Mol Biol. (2016) 1441:333-346;
Fang, et al., Semin Immunol. (2017) 31:37-54. Examples of a trispecific NK cell engager (TRiKE) include OXS-3550, and CD16-IL-15-B7H3
TriKe.
Phosphatidylinositol 3-kinase (PI3K) Inhibitors
[0213] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with a PI3K inhibitor. Examples
of PI3K inhibitors include idelalisib, alpelisib, buparlisib, CAI orotate, copanlisib,
duvelisib, gedatolisib, neratinib, panulisib, perifosine, pictilisib, pilaralisib,
puquitinib mesylate, rigosertib, rigosertib sodium, sonolisib, taselisib, AMG-319,
AZD-8186, BAY-1082439, CLR-1401, CLR-457, CUDC-907, DS-7423, EN-3342, GSK-2126458,
GSK-2269577, GSK-2636771, INCB-040093, LY-3023414, MLN-1117, PQR-309, RG-7666, RP-6530,
RV-1729, SAR-245409, SAR-260301, SF-1126, TGR-1202, UCB-5857, VS-5584, XL-765, and
ZSTK-474.
alpha-4/beta-7 antagonists
[0214] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with an alpha-4/beta-7 antagonist.
Examples of Integrin alpha-4/beta-7 antagonists include PTG-100, TRK-170, abrilumab,
etrolizumab, carotegrast methyl, and vedolizumab.
Pharmacokinetic Enhancers
[0215] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with a pharmacokinetic enhancer.
Examples of pharmacokinetic enhancers include cobicistat and ritonavir.
Additional Therapeutic Agents
HIV Combination Therapy
[0217] In a particular embodiment, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with one, two, three, four or more
additional therapeutic agents selected from ATRIPLA
® (efavirenz, tenofovir disoproxil fumarate, and emtricitabine); COMPLERA
® (EVIPLERA
®; rilpivirine, tenofovir disoproxil fumarate, and emtricitabine); STRIBILD
® (elvitegravir, cobicistat, tenofovir disoproxil fumarate, and emtricitabine); TRUVADA
® (tenofovir disoproxil fumarate and emtricitabine; TDF +FTC); DESCOVY
® (tenofovir alafenamide and emtricitabine); ODEFSEY
® (tenofovir alafenamide, emtricitabine, and rilpivirine); GENVOYA
® (tenofovir alafenamide, emtricitabine, cobicistat, and elvitegravir); adefovir; adefovir
dipivoxil; cobicistat; emtricitabine; tenofovir; tenofovir disoproxil; tenofovir disoproxil
fumarate; tenofovir alafenamide; tenofovir alafenamide hemifumarate; TRIUMEQ
® (dolutegravir, abacavir, and lamivudine); dolutegravir, abacavir sulfate, and lamivudine;
raltegravir; raltegravir and lamivudine; maraviroc; enfuvirtide; ALUVIA
® (KALETRA
®; lopinavir and ritonavir); COMBIVIR
® (zidovudine and lamivudine; AZT+3TC); EPZICOM
® (LIVEXA
®; abacavir sulfate and lamivudine; ABC+3TC); TRIZIVIR
® (abacavir sulfate, zidovudine, and lamivudine; ABC+AZT+3TC); rilpivirine; rilpivirine
hydrochloride; atazanavir sulfate and cobicistat; atazanavir and cobicistat; darunavir
and cobicistat; atazanavir; atazanavir sulfate; dolutegravir; elvitegravir; ritonavir;
atazanavir sulfate and ritonavir; darunavir; lamivudine; prolastin; fosamprenavir;
fosamprenavir calcium efavirenz; etravirine; nelfinavir; nelfinavir mesylate; interferon;
didanosine; stavudine; indinavir; indinavir sulfate; tenofovir and lamivudine; zidovudine;
nevirapine; saquinavir; saquinavir mesylate; aldesleukin; zalcitabine; tipranavir;
amprenavir; delavirdine; delavirdine mesylate; Radha-108 (receptol); lamivudine and
tenofovir disoproxil fumarate; efavirenz, lamivudine, and tenofovir disoproxil fumarate;
phosphazid; lamivudine, nevirapine, and zidovudine; abacavir; and abacavir sulfate.
[0218] It will be appreciated by one of skill in the art that the additional therapeutic
agents listed above may be included in more than one of the classes listed above.
The particular classes are not intended to limit the functionality of those compounds
listed in those classes.
[0219] In a specific embodiment, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with an HIV nucleoside or nucleotide
inhibitor of reverse transcriptase and an HIV non-nucleoside inhibitor of reverse
transcriptase. In another specific embodiment, the anti-HIV gp120 V3 glycan directed
antibodies or antigen-binding fragments, as defined by the claims, are combined with
an HIV nucleoside or nucleotide inhibitor of reverse transcriptase, and an HIV protease
inhibiting compound. In an additional embodiment, the anti-HIV gp120 V3 glycan directed
antibodies or antigen-binding fragments, as defined by the claims, are combined with
an HIV nucleoside or nucleotide inhibitor of reverse transcriptase, an HIV non-nucleoside
inhibitor of reverse transcriptase, and a pharmacokinetic enhancer. In certain embodiments,
the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding fragments, as
defined by the claims, are combined with at least one HIV nucleoside inhibitor of
reverse transcriptase, an integrase inhibitor, and a pharmacokinetic enhancer. In
another embodiment, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with two HIV nucleoside or nucleotide
inhibitors of reverse transcriptase.
[0220] In a particular embodiment, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with abacavir sulfate, tenofovir,
tenofovir disoproxil, tenofovir disoproxil fumarate, tenofovir disoproxil hemifumarate,
tenofovir alafenamide, or tenofovir alafenamide hemifumarate.
[0221] In a particular embodiment, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with tenofovir, tenofovir disoproxil,
tenofovir disoproxil fumarate, tenofovir alafenamide, or tenofovir alafenamide hemifumarate.
[0222] In a particular embodiment, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with a first additional therapeutic
agent selected from the group consisting of abacavir sulfate, tenofovir, tenofovir
disoproxil, tenofovir disoproxil fumarate, tenofovir alafenamide, and tenofovir alafenamide
hemifumarate, and a second additional therapeutic agent selected from the group consisting
of emtricitabine and lamivudine.
[0223] In a particular embodiment, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with a first additional therapeutic
agent selected from the group consisting of tenofovir, tenofovir disoproxil, tenofovir
disoproxil fumarate, tenofovir alafenamide, and tenofovir alafenamide hemifumarate,
and a second additional therapeutic agent, wherein the second additional therapeutic
agent is emtricitabine.
[0224] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with one or more additional therapeutic
agents in a therapeutically effective dosage amount in the range of e.g., from 1 mg
to 50 mg, 75 mg, 100mg, 150 mg, 200 mg, 250 mg, 300 mg, 400 mg, 500 mg, 1000 mg or
1500 mg of the anti-HIV gp120 V3 glycan directed antibody or antigen-binding fragment.
In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with one or more additional therapeutic
agents in a therapeutically effective dosage amount in the range of
e.g., from about 0.1 mg/kg to about 0.5 mg/kg, 1 mg/kg, 2 mg/kg, 3 mg/kg, 4 mg/kg, 5 mg/kg,
8 mg/kg, 10 mg/kg, 15 mg/kg, 20 mg/kg, 25 mg/kg, 30 mg/kg, 35 mg/kg, 40 mg/kg, 45
mg/kg or 50 mg/kg of the anti-HIV gp120 V3 glycan directed antibody or antigen-binding
fragment. In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies
or antigen-binding fragments, as defined by the claims, are combined with one or more
additional therapeutic agents in a therapeutically effective dosage amount in the
range of
e.g., from about 5 mg to about 10 mg, 20 mg, 25 mg, 50 mg, 100 mg, 125 mg, 150 mg, 250
mg, 300 mg, 500 mg, 1000 mg or 1500 mg of the anti-HIV gp120 V3 glycan directed antibody
or antigen-binding fragment.
[0225] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with 5-30 mg tenofovir alafenamide
fumarate, tenofovir alafenamide hemifumarate, or tenofovir alafenamide, and 200 mg
emtricitabine. In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies
or antigen-binding fragments, as defined by the claims, are combined with 5-10, 5-15,
5-20, 5-25, 25-30, 20-30, 15-30, or 10-30 mg tenofovir alafenamide fumarate, tenofovir
alafenamide hemifumarate, or tenofovir alafenamide, and 200 mg emtricitabine. In certain
embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding fragments,
as defined by the claims, are combined with 10 mg tenofovir alafenamide fumarate,
tenofovir alafenamide hemifumarate, or tenofovir alafenamide, and 200 mg emtricitabine.
In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with 25 mg tenofovir alafenamide
fumarate, tenofovir alafenamide hemifumarate, or tenofovir alafenamide, and 200 mg
emtricitabine. In some embodiments, the anti-HIV gp120 V3 glycan directed antibodies
or antigen-binding fragments, as defined by the claims, are combined with the agents
provided herein in any dosage amount of the anti-HIV gp120 V3 glycan directed antibodies
or antigen-binding fragments (e.g., from 1 mg to 500 mg of the anti-HIV gp120 V3 glycan
directed antibodies or antigen-binding fragments, as defined by the claims) the same
as if each combination of dosages were specifically and individually listed.
[0226] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with 200-400 mg tenofovir disoproxil
fumarate, tenofovir disoproxil hemifumarate, or tenofovir disoproxil, and 200 mg emtricitabine.
In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with 200-250, 200-300, 200-350,
250-350, 250-400, 350-400, 300-400, or 250-400 mg tenofovir disoproxil fumarate, tenofovir
disoproxil hemifumarate, or tenofovir disoproxil, and 200 mg emtricitabine. In certain
embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding fragments,
as defined by the claims, are combined with 300 mg tenofovir disoproxil fumarate,
tenofovir disoproxil hemifumarate, or tenofovir disoproxil, and 200 mg emtricitabine.
The anti-HIV gp120 V3 glycan directed antibodies or antigen-binding fragments may
be combined with the agents provided herein in any dosage amount (
e.g., from 1 mg to 500 mg of the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments) the same as if each combination of dosages were specifically and individually
listed.
Long-Acting HIV Inhibitors
[0227] In some embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, can be co-administered with a long-acting HIV
inhibitor. Examples of drugs that are being developed as long acting HIV inhibitors
include without limitation: cabotegravir LA, rilpivirine LA, any integrase LA, VM-1500
LAI, maraviroc (LAI), tenofovir implant, MK-8591 implant, long-acting dolutegravir.
HIV Vaccines
[0228] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with an HIV vaccine. Examples of
HIV vaccines include peptide vaccines, recombinant subunit protein vaccines, live
vector vaccines, DNA vaccines, HIV MAG DNA vaccines, CD4-derived peptide vaccines,
vaccine combinations, adenoviral vector vaccines (e.g., Ad5, Ad26 or Ad35), simian
adenovirus (chimpanzee, gorilla, rhesus i.e., rhAd), adeno-associated virus vector
vaccines, chimpanzee adenoviral vaccines (
e.g., ChAdOX1, ChAd68, ChAd3, ChAd63, ChAd83, ChAd155, ChAd157, Pan5, Pan6, Pan7, Pan9),
Coxsackieviruses based vaccines, enteric virus based vaccines, Gorilla adenovirus
vaccines, lentiviral vector based vaccine, bi-segmented or tri-segmented arenavirus
based vaccines (
e.g., LCMV, Pichinde), trimer-based HIV-1 vaccine, measles virus based vaccine, flavivirus
vector based vaccines, tobacco mosaic virus vector based vaccine, Varicella-zoster
virus based vaccine, Human parainfluenza virus 3 (PIV3) based vaccines, poxvirus based
vaccine (modified vaccinia virus Ankara (MVA), orthopoxvirus-derived NYVAC, and avipoxvirus-derived
ALVAC (canarypox virus) strains); fowlpox virus based vaccine, rhabdovirus-based vaccines,
such as Vesicular stomatitis virus (VSV) and marabavirus; recombinant human CMV (rhCMV)
based vaccine, alphavirus-based vaccines, such as semliki forest virus, venezuelan
equine encephalitis virus and sindbis virus (
see,
e.g.,
Lauer, et al., Clin Vaccine Immunol. (2017) 24(1): e00298-16); LNP formulated mRNA based therapeutic vaccines; and LNP-formulated self-replicating
RNA/self-amplifying RNA vaccines.
[0229] Examples of HIV vaccines include without limitation anti-CD40.Env-gp140 vaccine,
Ad4-EnvC150, BG505 SOSIP.664 gp140 adjuvanted vaccine, BG505 SOSIP.GT1.1 gp140 adjuvanted
vaccine, Chimigen HIV vaccine, ConM SOSIP.v7 gp140, rgp120 (AIDSVAX), ALVAC HIV (vCP1521)/AIDSVAX
B/E (gp120) (RV144), monomeric gp120 HIV-1 subtype C vaccine, MPER-656 liposome subunit
vaccine, Remune, ITV-1, Contre Vir, Ad5-ENVA-48, DCVax-001 (CDX-2401), Vacc-4x, Vacc-C5,
VAC-3S, multiclade DNA recombinant adenovirus-5 (rAd5), rAd5 gag-pol env A/B/C vaccine,
Pennvax-G, Pennvax-GP, Pennvax-G/MVA-CMDR, HIV-TriMix-mRNA vaccine, HIV-LAMP-vax,
Ad35, Ad35-GRIN, NAcGM3/VSSP ISA-51, poly-ICLC adjuvanted vaccines, TatImmune, GTU-multiHIV
(FIT-06), ChAdV63.HIVconsv, gp140[delta]V2.TV1+MF-59, rVSVIN HIV-1 gag vaccine, SeV-EnvF,
SeV-Gag vaccine, AT-20, DNK-4, ad35-Grin/ENV, TBC-M4, HIVAX, HIVAX-2, N123-VRC-34.01
inducing epitope-based HIV vaccine, NYVAC-HIV-PT1, NYVAC-HIV-PT4, DNA-HIV-PT123, rAAV1-PG9DP,
GOVX-B11, GOVX-B21, GOVX-C55, TVI-HIV-1, Ad-4 (Ad4-env Clade C+Ad4-mGag), Paxvax,
EN41-UGR7C, EN41-FPA2, ENOB-HV-11, PreVaxTat, AE-H, MYM-V101, CombiHIVvac, ADVAX,
MYM-V201, MVA-CMDR, MagaVax, DNA-Ad5 gag/pol/nef/nev (HVTN505), MVATG-17401, ETV-01,
CDX-1401, DNA and Sev vectors vaccine expressing SCaVII, rcAD26.MOS1.HIV-Env, Ad26.Mod.HIV
vaccine, Ad26.Mod.HIV + MVA mosaic vaccine + gp140, AGS-004, AVX-101, AVX-201, PEP-6409,
SAV-001, ThV-01, TL-01, TUTI-16, VGX-3300, VIR-1111, IHV-001, and virus-like particle
vaccines such as pseudovirion vaccine, CombiVICHvac, LFn-p24 B/C fusion vaccine, GTU-based
DNA vaccine, HIV gag/pol/nef/env DNA vaccine, anti-TAT HIV vaccine, conjugate polypeptides
vaccine, dendritic-cell vaccines, gag-based DNA vaccine, GI-2010, gp41 HIV-1 vaccine,
HIV vaccine (PIKA adjuvant), I i-key/MHC class II epitope hybrid peptide vaccines,
ITV-2, ITV-3, ITV-4, LIPO-5, multiclade Env vaccine, MVA vaccine, Pennvax-GP, pp71-deficient
HCMV vector HIV gag vaccine, recombinant peptide vaccine (HIV infection), NCI, rgp160
HIV vaccine, RNActive HIV vaccine, SCB-703, Tat Oyi vaccine, TBC-M4, therapeutic HIV
vaccine, UBI HIV gp120, Vacc-4x + romidepsin, variant gp120 polypeptide vaccine, rAd5
gag-pol env A/B/C vaccine, . DNA.HTI and MVA.HTI, VRC-HIVDNA016-00-VP + VRC-HIVADV014-00-VP,
INO-6145, JNJ-9220, gp145 C.6980; eOD-GT8 60mer based vaccine, PD-201401, env (A,
B, C, A/E)/gag (C) DNA Vaccine, gp120 (A,B,C,A/E) protein vaccine, PDPHV-201401, Ad4-EnvCN54,
EnvSeq-1 Envs HIV-1 vaccine (GLA-SE adjuvanted), HIV p24gag prime-boost plasmid DNA
vaccine, HIV-1 iglb12 neutralizing VRC-01 antibody-stimulating anti-CD4 vaccine, MVA-BN
HIV-1 vaccine regimen, UBI HIV gp120, mRNA based prophylactic vaccines, VPI-211, and
TBL-1203HI.
Birth control (contraceptive) combination therapy
[0230] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with a birth control or contraceptive
regimen. Therapeutic agents used for birth control (contraceptive) include cyproterone
acetate, desogestrel, dienogest, drospirenone, estradiol valerate, ethinyl Estradiol,
ethynodiol, etonogestrel, levomefolate, levonorgestrel, lynestrenol, medroxyprogesterone
acetate, mestranol, mifepristone, misoprostol, nomegestrol acetate, norelgestromin,
norethindrone, noretynodrel, norgestimate, ormeloxifene, segestersone acetate, ulipristal
acetate, and any combinations thereof.
Gene Therapy and Cell Therapy
[0231] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with a gene or cell therapy regimen.
Gene therapy and cell therapy include without limitation the genetic modification
to silence a gene; genetic approaches to directly kill the infected cells; the infusion
of immune cells designed to replace most of the patient's own immune system to enhance
the immune response to infected cells, or activate the patient's own immune system
to kill infected cells, or find and kill the infected cells; genetic approaches to
modify cellular activity to further alter endogenous immune responsiveness against
the infection. Examples of cell therapy include LB-1903,ENOB-HV-01, GOVX-B01, and
SupT1 cell based therapy. Examples of dendritic cell therapy include AGS-004. CCR5
gene editing agents include SB-728T. CCR5 gene inhibitors include Cal-1. In some embodiments,
C34-CCR5/C34-CXCR4 expressing CD4-positive T-cells are co-administered with the anti-HIV
gp120 V3 glycan directed antibodies or antigen-binding fragments. In some embodiments,
the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding fragments, as
defined by the claims, are co-administered with AGT-103-transduced autologous T-cell
therapy or AAV-eCD4-Ig gene therapy.
Gene Editors
[0232] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with a gene editor, e.g., an HIV
targeted gene editor. In various embodiments, the genome editing system can be selected
from the group consisting of: a CRISPR/Cas9 complex, a zinc finger nuclease complex,
a TALEN complex, a homing endonucleases complex, and a meganuclease complex. An illustrative
HIV targeting CRISPR/Cas9 system includes without limitation EBT-101.
CAR-T-cell therapy
[0233] In some embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, can be co-administered with a population of immune
effector cells engineered to express a chimeric antigen receptor (CAR), wherein the
CAR comprises an HIV antigen binding domain. The HIV antigen include an HIV envelope
protein or a portion thereof, gp120 or a portion thereof, a CD4 binding site on gp120,
the CD4-induced binding site on gp120, N glycan on gp120, the V2 of gp120, the membrane
proximal region on gp41. The immune effector cell is a T-cell or an NK cell. In some
embodiments, the T-cell is a CD4+ T-cell, a CD8+ T-cell, or a combination thereof.
Cells can be autologous or allogeneic. Examples of HIV CAR-T include convertibleCAR-T,
VC-CAR-T, anti-CD4 CART-cell therapy, autologous hematopoietic stem cells genetically
engineered to express a CD4 CAR and the C46 peptide.
TCR-T-cell therapy
[0234] In certain embodiments, the anti-HIV gp120 V3 glycan directed antibodies or antigen-binding
fragments, as defined by the claims, are combined with a population of TCR-T-cells.
TCR-T-cells are engineered to target HIV derived peptides present on the surface of
virus-infected cells.
6. Kits
EXAMPLES
[0235] The following examples are offered to illustrate, but not to limit the claimed invention.
Example 1
Identification of HIV-Infected Patients Responsive to Therapy With An Anti-HIV gp120
V3-Glycan Directed Antibody or Antigen-Binding Fragment Thereof
[0236] This Example demonstrates identification of Env genotypes associated with viral susceptibility
to neutralization by PGT121 and its derivative, GS-9722 (elipovimab), for prescreening
of HIV-infected subjects for susceptibility to PGT121/GS-9722.
[0237] High level of sequence diversity in the HIV envelope gene makes prescreening of subjects
in clinical trials for broadly neutralizing antibodies (bNAbs) attractive to increase
the likelihood of a high response rate. To identify an Env genotype that is predictive
of viral susceptibility to PGT121 and GS-9722, we examined the PGT121 and GS-9722
neutralization data and corresponding Env sequence for 206 clade B Envs.
[0238] GS-9722 is a engineered variant of PGT121 that maintains the same neutralization
activity as PGT121, as evidenced by a highly statistically significant correlation
of PGT121 and GS-9722 neutralization IC50s among 397 HIV strains tested with PGT121
and GS-9722 (r
2=0.9698, P<0.0001). We therefore combined the GS-9722 neutralization data obtained
on 140 clade B Envs isolated from viremic subjects enrolled in Gilead-sponsored clinical
trials, with publicly-available PGT121 neutralization data obtained from the Los Alamos
HIV Sequence Database (n=66) to increase the statistical power.
[0239] Full length Env amino acid sequences were aligned using ClustalW and manually adjusted
upon visual inspection. To identify genotypes associated with sensitivity to neutralization
by PGT121/GS-9722, we compared the frequency of amino acids and potential N-linked
glycosylation sites (PNGS) at each residue among PGT121/GS-9722-sensitive viruses
to the frequency in PGT121/GS-9722-resistant viruses by Fisher's exact test. An N-linked
glycosylation motif is N-X-S/T, where X is any residue except proline. Neutralization
sensitivity to PGT121/GS-9722 was defined as IC50 <1 µg/mL. For residues that were
statistically significantly associated with sensitivity to PGT121/GS-9722, the positive
predictive value (PPV;
i.
e., probability Env is sensitive to PGT121/GS-9722 when genotype is present) and sensitivity
(
i.e., probability that the genotype is present when Env is sensitive to PGT121/GS-9722)
were calculated as described below:
Table 1
| 2 × 2 Table Used to Calculate PPV, NPV, Sensitivity and Specificity for Genotypic
Determinants of PGT121/GS-9722 Sensitivity |
| |
PGT121/GS-9722 sensitive |
PGT121/GS-9722 resistant |
| Genotype (+) |
a |
c |
| Genotype (-) |
b |
d |

[0240] A Mann-Whitney test was also applied to identify determinants of susceptibility independent
of the 1 µg/mL cut-off for defining Envs as "susceptible" vs "resistant".
[0241] Residues that were statistically associated with susceptibility to PGT121/GS-9722
and/or previously are reported to be associated with PGT121 susceptibility are listed
in Table 2, ranked by descending PPV. Of the residues previously reported to confer
susceptibility to PGT121, 307I, 295 PNGS and 300 PNGS were not statistically associated
with susceptibility to PGT121/GS-9722 in this clade B dataset. We identified many
previously unreported residues to be significantly associated with susceptibility
to PGT121/GS-9722.
Table 2
| Individual genotypes associated with susceptibility to PGT121/GS-9722 neutralization
among clade B Envs |
| Virus genotype1 |
PPV |
Sensitivity |
Fisher's Exact P value |
Mann-Whitney P value |
| K677 |
78.8 |
31.8 |
0.005 |
0.002 |
| not_W17 |
75.3 |
47.3 |
0.0031 |
0.0001 |
| 332 glycan* |
75.1 |
98.4 |
0.0001 |
0.0001 |
| not_R747 |
74.4 |
51.9 |
0.0023 |
0.0075 |
| insertion_321.01 |
73.8 |
45.7 |
0.0118 |
0.0365 |
| E429 |
71.7 |
80.6 |
0.0001 |
0.0001 |
| Q442 |
70.7 |
50.4 |
0.0423 |
0.0155 |
| T63 |
69.6 |
86.8 |
0.0002 |
0.0009 |
| R335 |
69.3 |
47.3 |
0.1092 |
0.0035 |
| H330* |
68.9 |
87.6 |
0.0003 |
0.0009 |
| i165 |
68.3 |
66.7 |
0.0397 |
0.1486 |
| D325* |
67.3 |
89.1 |
0.0037 |
0.0033 |
| T320 |
66.5 |
86.0 |
0.0266 |
0.0193 |
| L179 |
66.0 |
81.4 |
0.0855 |
0.0123 |
| 5393 |
65.2 |
82.9 |
0.1529 |
0.0165 |
| 301 glycan* |
64.5 |
98.4 |
0.0158 |
0.0147 |
| i307* |
64.1 |
91.5 |
0.2443 |
0.5291 |
| 295 glycan* |
63.9 |
76.7 |
0.617 |
0.1188 |
| N300* |
61.9 |
74.4 |
0.7423 |
0.0629 |
| no selection |
62.6 |
100 |
na |
na |
1Virus genotype, indicates the presence of specific amino acid residues translated
from the HIV envelope gene
* Residue reported in the literature to confer susceptibility to PGT121 neutralization
(Julg et al, Sci Transl Med. (2017) 9(408)). |
[0242] Since an epitope is comprised of more than one residue, combinations of genotypic
determinants that were statistically associated with susceptibility to PGT121/ GS-9722
were evaluated to see if combining individual genotypic determinants improved the
PPV by preferentially enriching true positives over false positives. Consideration
was also given to sensitivity since genotypes with low sensitivity will require screening
of a larger number of subjects in order to enroll sufficient number of subjects in
clinical trials.
[0243] The combination genotypes that provided the highest PPV and sensitivity are listed
in Table 3 and displayed in Figure 1. Several combination genotypes that incorporated
previously unreported genotypes associated with susceptibility to PGT121/GS-9722 neutralization
provided higher PPV than was achievable using only previously described genotypes.
The highest PPV obtained was 98.4% (for viruses containing the amino acids N332 glycan/D325/H330/T63/T320/L179),
which represents a 57% increase over the positive predictive value of 62.6% with no
genotype selection.
Table 3
| Individual and combination genotypes associated with susceptibility to PGT121/GS-9722
neutralization among clade B Envs |
| Virus genotype1 |
PPV |
Sensitivity |
Fisher's Exact P value |
Mann-Whitney P value |
| N332glycan/D325/H330/T63/T320/L179 |
98.4 |
47.3 |
0.0001 |
0.0001 |
| N332glycan/D325/H330/T63/T320 |
93.7 |
57.4 |
0.0001 |
0.0001 |
| N332glycan/D325/H330/T320/L179 |
93.3 |
54.3 |
0.0001 |
n.a. |
| N332glycan/D325/H330/T63 |
91.6 |
67.4 |
0.0001 |
0.0001 |
| N332glycan/D325/H330/T320 |
86.1 |
67.4 |
0.0001 |
0.0001 |
| 332PNGS/301 PNGS/D325/H330* |
83.9 |
76.7 |
0.0001 |
0.0001 |
| N332glycan/D325/H330* |
83.5 |
78.3 |
0.0001 |
0.0001 |
| N332glycan/D325* |
80.7 |
87.6 |
0.0001 |
0.0001 |
| glycan332 |
75.1 |
98.4 |
0.0001 |
0.0001 |
| glycan301 |
64.5 |
98.4 |
0.0158 |
0.0147 |
| D325 |
67.3 |
89.1 |
0.0037 |
0.0033 |
| H330 |
68.9 |
87.6 |
0.0003 |
0.0009 |
| T63 |
69.6 |
86.8 |
0.0002 |
0.0009 |
| T320 |
66.5 |
86 |
0.0266 |
0.0193 |
| L179 |
66 |
81.4 |
0.0855 |
0.0123 |
| no selection2 |
62.6 |
100 |
n.a. |
n.a. |
1 Virus genotype, indicates the presence of specific amino acid residues translated
from the HIV envelope gene
3 None, indicates 206 subtype B viruses without selection for specific amino acids
in the HIV envelope gene
* indicates genotypes comprised of residues previously reported in the literature
to be associated with susceptibility to PGT121. See, e.g., Julg et al, Sci Transl Med. (2017) 9(408). |
[0244] The combination genotypes for PGT121/GS-9722 in Table 3 for clade B were used to
determine PPV, sensitivity and prevalence for clade A (Table 4) and clade C (Table
5) using neutralization data and corresponding Env sequence for 66 clade A Envs and
258 clade C Envs. The clade A and clade C datasets were publicly-available data obtained
from the Los Alamos HIV Sequence Database. The highest PPV obtained for clade A was
93.8% (for viruses containing the amino acids N332glycan/D325/H330/T320/L179), which
represents an 88% increase over the positive predictive value of 50% with no genotype
selection. The highest PPV obtained for clade C was 89.3% (for viruses containing
the amino acids N332glycan/D325/H330/T320/L179), which represents a 53% increase over
the positive predictive value of 58.5% with no genotype selection.
Table 4
| Individual and combination genotypes associated with susceptibility to PGT121 neutralization
among clade A Envs |
| Virus genotype1 |
PPV |
Sensitivity |
Prevalence |
| N332glycan/D325/H330/T63/T320/L179 |
92.9 |
39.4 |
21.2 |
| N332glycan/D325/H330/T63/T320 |
70.8 |
51.5 |
36.4 |
| N332glycan/D325/H330/T63 |
69.2 |
54.6 |
39.4 |
| N332glycan/D325/H330/T320/L179 |
93.8 |
45.5 |
24.2 |
| N332glycan/D325/H330/T320 |
73.1 |
57.6 |
39.4 |
| N332glycan/D325/H330 |
71.4 |
60.6 |
42.4 |
| N332glycan/D325 |
68.8 |
66.7 |
48.5 |
| glycan332 |
68.4 |
78.8 |
57.6 |
| no selection2 |
50 |
100 |
100 |
1 Virus genotype, indicates the presence of specific amino acid residues translated
from the HIV envelope gene
2 None, indicates 66 clade A viruses without selection for specific amino acids in
the HIV envelope gene |
Table 5
| Individual and combination genotypes associated with susceptibility to PGT121 neutralization
among clade C Envs |
| Virus genotype1 |
PPV |
Sensitivity |
Prevalence |
| N332glycan/D325/H330/T63/T320/L179 |
81.8 |
6.0 |
4.3 |
| N332glycan/D325/H330/T63/T320 |
85.7 |
8.0 |
5.4 |
| N332glycan/D325/H330/T63 |
86.7 |
8.6 |
5.8 |
| N332glycan/D325/H330/T320/L179 |
89.3 |
44.4 |
29.1 |
| N332glycan/D325/H330/T320 |
88.0 |
62.9 |
41.9 |
| N332glycan/D325/H330 |
86.6 |
72.9 |
49.2 |
| N332glycan/D325 |
81.1 |
82.1 |
59.3 |
| glycan332 |
73.7 |
92.7 |
73.6 |
| no selection2 |
58.5 |
100 |
100 |
1 Virus genotype, indicates the presence of specific amino acid residues translated
from the HIV envelope gene
2 None, indicates 258 clade C viruses without selection for specific amino acids in
the HIV envelope gene |
[0245] The prevalence of individual amino acids (T63, L179, T320, D325, H330, N332, NotP333
and S/T334) used in the PGT121/GS-9722 combination genotypes were determined for the
clade A, clade B and clade C virus sequences (Table 6). All amino acids show prevalence
above 60% in clade B, in clade A except for L179 (51.5%), and in clade C except for
T63 (10.1%).
Table 6
| Prevalence of individual amino acids in clade A, clade B and clade C viruses |
| Position |
Prevalence1 |
| clade A |
clade B |
clade C |
| T63 |
84.8 |
78.2 |
10.1 |
| L179 |
51.5 |
77.2 |
63.2 |
| T320 |
89.4 |
81.1 |
86 |
| D325 |
80.3 |
83 |
80.2 |
| H330 |
72.7 |
79.6 |
75.2 |
| N332 |
66.7 |
86.9 |
83.7 |
| NotP333 |
100 |
100 |
100 |
| S/T334 |
62.1 |
84 |
77.6 |
| 1 Analysis based on the 66 clade A, 206 clade B and 258 clade C viruses from the PGT121/GS-9722
datasets |
[0246] 10-1074 is a broadly neutralizing antibody that targets the V3 glycan region of HIV
gp120 and that is related to PGT121/GS-9722.
See, e.g., Mouquet, et al., Proc Natl Acad Sci U S A. 2012 Nov 20;109(47):E3268-77 and
Walker, et al., Nature. 2011 Sep 22;477(7365):466-70. The combination genotypes for PGT121/GS-9722 in Table 3 were used to determine PPV,
sensitivity and prevalence for 10-1074 using neutralization data and corresponding
Env sequence for 315 clade B Envs (Table 7). The 315 clade B dataset consisted of
143 clade B Envs isolated from viremic subjects enrolled in Gilead-sponsored clinical
trials and 172 clade B Envs from publicly-available data obtained from the Los Alamos
HIV Sequence Database. The highest PPV obtained was 100% (for viruses containing the
amino acids N332glycan/D325/H330/T63/T320/L179), which represents a 61% increase over
the positive predictive value of 62.2% with no genotype selection.
Table 7
| Individual and combination genotypes associated with susceptibility to 10-1074 neutralization
among clade B Envs |
| Virus genotype1 |
PPV |
Sensitivity |
Prevalence |
| N332glycan/D325/H330/T63/T320/L179 |
100.0 |
38.8 |
24.1 |
| N332glycan/D325/H330/T63/T320 |
99.0 |
51.5 |
32.4 |
| N332glycan/D325/H330/T63 |
98.5 |
65.8 |
41.6 |
| N332glycan/D325/H330/T320/L179 |
96.8 |
46.4 |
29.8 |
| N332glycan/D325/H330/T320 |
94.4 |
59.7 |
39.4 |
| N332glycan/D325/H330* |
93.6 |
75.0 |
49.8 |
| N332glycan/D325 |
92.2 |
84.7 |
57.1 |
| glycan332 |
86.9 |
98.0 |
70.2 |
| no selection2 |
62.2 |
100 |
100 |
1 Virus genotype, indicates the presence of specific amino acid residues translated
from the HIV envelope gene
2 None, indicates 315 clade B viruses without selection for specific amino acids in
the HIV envelope gene |
[0247] Subsequently, the highest scoring genotypic algorithms (Table 3) were applied to
analyze pre-ART plasma samples from HIV infected individuals from the Zurich Primary
HIV Infection Cohort Study (ZPHI) to predict whether they would be sensitive to GS-9722
treatment. A total of 92 individual plasma samples were analyzed in a NGS assay of
the HIV envelope gene (GenoSure HIV Envelope RNA Assay, Monogram Biosciences, South
San Francisco, CA). Subjects were characterized as positive for a given genotype if
the derived virus sequences contained the amino acids specified by the algorithm without
sequence variability (zero sequence variability on the specified positions). With
these criteria, 47/92, 37/92, 32/92, 27/92, 22/92, and 16/92 subjects were predicted
to be sensitivity to GS-9722 (Figure 1) with corresponding positive predictive values
of 80.7%, 83.5%, 86.1%, 91.6%, 93.7%, and 98.4%, respectively (Table 3). For clade
B infected subjects (59 of the 92 subjects), 35/59, 27/59, 22/59, 23/59, 18/59, and
12/59 were predicted to be sensitivity to GS-9722 (Figure 2) with corresponding positive
predictive values of 80.7%, 83.5%, 86.1%, 91.6%, 93.7%, and 98.4%, respectively (Table
3).
[0248] The 100% conservation (zero sequence variability on the specified positions) of the
individual amino acids (T63, L179, T320, D325, H330, N332, NotP333 and S/T334) used
in the combination genotypes for GS-9722 sensitivity prediction was determined for
pre-ART plasma samples for all subjects (n=92) and for the subset of subjects infected
with clade B (n=59), (Table 8).
Table 8
| 100% conservation of individual amino acids in ZPHI subjects |
| Position |
100% conservation (% of subjects) |
| All subjects |
Clade B infected subjects |
| T63 |
64 |
75 |
| L179 |
59 |
58 |
| T320 |
86 |
85 |
| D325 |
70 |
73 |
| H330 |
65 |
71 |
| N332 |
76 |
85 |
| NotP333 |
100 |
100 |
| S/T334 |
74 |
85 |
| 1 Analysis based on 92 (all subjects) and 59 (clade B subjects) pre-ART plasma samples
from ZPHI individuals |
[0249] To confirm the genotypic prediction for sensitivity to GS-9722, virus swarms from
pre-ART plasma samples from ZPHI were cloned and evaluated in a GS-9722 neutralization
assay (PhenoSense HIV Entry Assay, Monogram Biosciences, South San Francisco, CA).
Virus was derived from 29 clade B samples with positive predictive values of 80.7%
or higher. The derived viruses were characterized as GS-9722 sensitive when IC50s
were 1 µg/ml or below. With these criteria, 25/29, 20/22, 16/18, 18/20, 14/16, and
10/11 viruses were confirmed to be sensitivity to GS-9722 (Figure 2) with corresponding
positive predictive values of 80.7%, 83.5%, 86.1%, 91.6%, 93.7%, and 98.4%, respectively
(Table 3).
[0250] To further confirm the genotypic prediction and phenotypic sensitivity to GS-9722,
20 individual viruses from 4 virus swarms from pre-ART plasma samples from ZPHI were
subcloned and evaluated in a GS-9722 neutralization assay (PhenoSense HIV Entry Assay,
Monogram Biosciences, South San Francisco, CA). All individual viruses were sensitive
to GS-9722 with comparable IC50s to the swarm virus (Figure 4).